SecReT6
Protein ID: 218929998
SecReT6 ID21
T6SS typei3
Gene symbol-
Locus tagYPO2947
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]3292603..3294483 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ7CJD2
KEGG IDypk:y1537, ypm:YP_2574, ype:YPO2947
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-202, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|218929998|ref|YP_002347873.1| hypothetical protein YPO2947 [Yersinia pestis CO92]
MDHKFLDYYNKELTFMREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPK
FTQRLLDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWP
LEIAEARLSSVPPDMPNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFEL
LHASHVATIIRAGHGETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQ
LSQSLRDNHTGEAEIIILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSR
PLDYEVFAINKVFGQQAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEV
FVSLVDQQEAPYGDSLRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDE
SAWRLIRQLSFNYLPLSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVY
GRGICCTLTVDEEGFSGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|16120353|ref|NC_003143.1|:3292603-3294483 Yersinia pestis CO92 chromosome, complete genome
GTGGATCACAAATTTCTTGACTATTACAATAAAGAACTCACTTTTATGCGCGAGATGGCGCAAGAGTTTG
CTGAAAAACATCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGATTGAAGTCGCCGACCCTTACGTTGA
GCGGCTGATAGAGTCCTTCTGTTTTTTATCTGCCAGAACGCAGATTAAGTTGGATGCTGAGTTTCCTAAA
TTTACTCAGCGTCTTTTGGACATTGTCTATCCCAATTACAATTCGCCAACCCCCTCAATGGGCGTGATCC
AACTTAAGCCAAATCTGAAGGAAGGAGATTTGACTCAAGGGTATTGTGTTCCCAGGGGCAGCTCGTTCTT
CACCCATATCGCACCTGGCGAGACAACCCGCTGCGAGTTCCGCAGTGGTCAGGATGTGGAGTTGTGGCCA
CTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATGCCTAATCTGGAAAAGCACCGCATTG
CCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAGTGGGCGATCTCACTTTCTCACAATT
AGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACGAATCGTTTCACATATCTTCGAGCTA
CTCCACGCCAGCCATGTTGCTACCATCATACGGGCAGGCCACGGAGAGACAGCAAAAGACACCGTGATCA
GTGATCAGCCACTGTCCTTTGAAGGGCTAAGCCCCGACCAAAGCCTACTGCCGCTATCATGGAATATCTT
TCACGGACATAATCTGGTGCAGGAATACTTTACCTGCCGCCAGCGTTTCTACTTTTTTACGCTGACACAG
CTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGGAAATCATCATCCTACTGGACAGATTACCGC
AGGATTTGGTGAGCCATGTTGCCCCCTCTCGCTTCCTGTTAGCCTGCACGCCAGTGATTAATCTCTTTCC
TAAACGCATGGATAAGATCGAAATTAACCGTGCACTGAACGATTTTCACGTAGTACCAGACCGTAGCCGC
CCACTGGATTATGAGGTTTTCGCCATTAATAAAGTGTTTGGTCAACAGGCGGAAACCAGCAACGAGGTGG
TATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACTTTGGGCGTTATTTCTCCATCACCCG
CAAGGCCAGAACGGGCGATAGCAACAAAAGAAAATATGACACCCGCACGCCTTACGCCAGTACCGAGGTC
TTTGTCTCGTTGGTCGATCAACAAGAGGCTCCTTATGGCGATAGCTTGCGCTACCTCTCTATTGAAGCTC
AGGTGACTAATCGGGATCTTCCGCGCCTGATTTCCGCCAGTGGTAATTTTGAATTGACCATGTCGGATTC
AGCGCCCGTTCACGGTGCCCGGTTTGTCTTCCAACCCAGCGCCCCACGCGCCCCCTTTGCCATGGATGAA
TCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCACTGTCAGATATGTCCCACTCGAATG
GGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTTCAGACCATGAATCGAATACACAAAT
TGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTTACCCGGCAATGGCCTACTGGTTTAT
GGCCGGGGCATCTGCTGCACTTTGACCGTGGATGAAGAAGGATTCTCCGGTATCAGCCCTTATCTATTTG
GCATGATCATGGAAAATTATGTGGCCCGCCATGCCGCAATAAATGTGTTTACCGAGACCGAGCTAAACTC
CATGCAAAGAGGACGTGTCGGTCATTGGAAAGCCCGCCCTGGCAGACGAGGAGTCCTGTAA