SecReT6
Protein ID: 218930004
SecReT6 ID21
T6SS typei3
Gene symbol-
Locus tagYPO2953
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]3299884..3301566 [+]
Producthypothetical protein
NoteTagL
UniProt IDQ7CJD5
KEGG IDypk:y1530, ype:YPO2953, ypm:YP_2580
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 191..217
OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 441..539
Protein Sequence: 560 a.a.     [Download]
>gi|218930004|ref|YP_002347879.1| hypothetical protein YPO2953 [Yersinia pestis CO92]
MFKVKLNKTLSLLWLAAVGALLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKHPQVSTPIPQET
AEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSARVLTFFPF
LPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEIT
QALQSLSQRLELQDINHSRFATQRNVMAHNLFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRH
GAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAMKPRVKTPVIKPTPASRGWLWSVCFAAVLLASHM
LNTLWQEKNRHEQFNQQMVPLDNISDFSAQYLARSITQLTDEGKILTTCVNTFDVTRWGLSQCKTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVERNKEKKILIVGHSDNTGSSSMNM
ALSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|16120353|ref|NC_003143.1|:3299884-3301566 Yersinia pestis CO92 chromosome, complete genome
ATGTTTAAGGTTAAATTGAATAAAACGCTCTCTCTATTATGGCTGGCTGCGGTCGGCGCCCTATTGGTGA
GTGTGAATTTTAAGGGAAATGCGTTATGGAATAACGTTATTTTCATTACTTTCCTGGCGCTGATGGTTCT
TGCCATCTGGAAACATTACGCCCTCAAACCCAAACACCCCCAAGTGTCGACTCCCATTCCGCAGGAGACA
GCGGAACCTGTAGAACAGGAGAGTACGGTTATTTTAATTCTCGGTCCCTATGCTGAGAAATGGTTTAGTA
ACCCAGAATCGCCAGACAGTACACGTTTTTCCAGCCATGCGGTTTGGATATTAATCACGAATCCCGCCGC
GCTGCAAAAACGCCTCACATATATTGCTGAACATCATCCATCCGCTCGGGTATTGACCTTTTTCCCTTTC
TTGCCGGATGTCTATGAGAATGCAGCAGTGATGATGTCAAAACTCACTGTGTGGCAGAACACTTTTTCAA
CGTTATCACTGCGATCCCCCCTCCCCTGCGTATTTGCTATTTACGCGCAGTTGAGTAATGAACGCCTTAG
CCATAATTCTGATAACGCATATTGGACTGGAAATATTAATCTTGCGAACCAGCAGCCTATCGAGATTACG
CAAGCCCTACAGTCACTGAGCCAACGACTTGAGTTACAAGACATCAATCACTCAAGATTTGCAACTCAGC
GTAATGTTATGGCGCATAATTTATTTACTTGGTTGAATGAATCGGGGGTGACAAACCTTCTGCAATCTAT
TTTCTCTCGCACCCCCTTACGGCTAACAGATGTCATTTTGTCGGATAATGGCAAAGGGTTCATCAGGCAT
GGTGCCTGGTCAGCCTGGCTGGAAAAAAAGTTTGGCATCATACCAAGCTTAGCCTCAACCTTGTCACTGC
CACCTTTCCCAGCGGTGATCAATGACCAGAAGCCCGCAATGAAACCACGGGTGAAAACACCGGTGATAAA
ACCTACCCCCGCATCCCGCGGGTGGTTATGGAGTGTATGCTTCGCCGCGGTGCTATTAGCCTCACATATG
CTAAACACCCTGTGGCAAGAAAAAAACCGGCATGAGCAATTTAACCAACAGATGGTGCCGTTGGACAATA
TCAGCGATTTTTCTGCTCAGTACCTGGCACGCAGCATCACCCAGTTAACTGATGAAGGTAAAATATTAAC
CACATGCGTTAATACATTTGATGTCACACGTTGGGGGCTGTCTCAATGCAAGACGTTATTAAGCCAAATC
AACCGCCGGATTGAATCCTATGAAAATATTCCTGTTTTCAGTTTTGCCCAAAAGCTCCCTCTGTTTGACT
CAAACAGTACCAAGCTGAAACTGAACTCACAAACTAATGAAATGATGATGGAGTTGTTATCACTGGTCGA
ACGGAATAAAGAGAAAAAAATCTTAATTGTTGGCCATTCTGATAACACAGGCAGTTCCTCCATGAACATG
GCACTTTCCGAACAGCGTGCGCTGGCCCTTCGCGATTGGTTAATTAAACGCAGTGATATCACTGTCGATA
ATTTTATTACCAAGGGAATGGGGGCTTCAGAACCGGTTGCGACCAATCACACGGAAGCGGGTCGAGAACA
AAACAGACGCGTCGAAGTACTGATATTACCCACACAAGATAGAACAAGAATGACGGAGCCTAAACCTTTA
TGA