SecReT6
Protein ID: 218930604
SecReT6 ID22
T6SS typeN/A
Gene symbol-
Locus tagYPO3594
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]4001721..4002770 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ0WB59
KEGG IDype:YPO3594
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-93, Aligned region: 25..335
Protein Sequence: 349 a.a.     [Download]
>gi|218930604|ref|YP_002348479.1| hypothetical protein YPO3594 [Yersinia pestis CO92]
MVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPANEAIRFKSTASLAFPT
RDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMNVFNHRLLTLLHQIWRK
YRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEVICSLVSHCFNLPD
ITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLLCINKLTREQFLSF
LPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDPEQKPSVTIGVME
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|16120353|ref|NC_003143.1|:4001721-4002770 Yersinia pestis CO92 chromosome, complete genome
GTGGTTGAGGATGTAAGTGGGGTTGAGAATGTAAATGGGGTTGAGGCAAGACCCGAAGGGCAGGCATTGG
ATGTTTCACGTTATAACTTTTTTCAATTGGTCGAATTGCTCAACCAATTGGCGGTAGCGTGGCAAGGTGC
GGCCCCTGTGGCGACCCCAGCCAATGAAGCCATCCGTTTTAAATCGACCGCCAGTTTAGCATTCCCGACC
AGAGATGTGATCGCACTGGACACCTCCGCCCGAGGTCAATTTGAGTTAGAGGTCTCTTTCCTTGGATTGC
ATGGCAGCCAATCGCCGCTACCAGGATATTACCTCGATTCGTTAGCGTGGGAGGATGCGCAGAATGAGAA
CCGGCTAACGGATTTCATGAACGTATTCAACCACCGCCTGTTAACGCTACTGCATCAGATTTGGCGTAAA
TACCGTTACTACATCTGCTTTGACAATGGCGGTGATGATGCATTTTCACAACGCATGTTCTCGCTGGTGG
GGTTAGGTAGCGAGGTCGTCCGCAATAAATTGCAGATCAATCACAGCAAAATGCTGGCTTATGCAGGGCT
GCTGGCCAGCCCCGGCAGAGCACCTGAAGTGATTTGCAGCCTTGTCTCACATTGCTTCAATTTGCCAGAT
ATCACCTTACACAGTTGGCAGCTACGCAAAGTGGATATTGCCCCCTCACAGCAGAATCGCTTGGGGACGA
GGGTGAAAGTCCGTGGCAAGAAATATGATGAAAAATCAGTGCTTGGCGTTAATTTCTCCATCGGTTCACG
GGTTGCGGATCGTAGCGGGAAATTCTTGTTGTGCATCAATAAGCTGACGCGAGAACAGTTCTTATCCTTT
TTACCCAACGGGGCTAATTACGCCTCGTTAGTGATGTTTGTCGCCTTCATTATGCGCGATCAATTCGCGT
GGGATTTACGCCTTGGGTTGGCCGAGCAACAGGTGGGCGGGATGGTGTTGGGAACCGAGCAAAATAGCCT
ATTGGGCTGGACCAGTATCCTCGGCGATCCCGAACAGAAACCCAGCGTAACGATTGGTGTAATGGAATAA