SecReT6
Protein ID: 218930605
SecReT6 ID22
T6SS typeN/A
Gene symbol-
Locus tagYPO3595
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]4002896..4004212 [+]
Producthypothetical protein
NoteFha
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0047, Aligned region: 34..100
FHA [PF00498], Evalue: 0.0047, Aligned region: 224..239
Protein Sequence: 438 a.a.     [Download]
>gi|218930605|ref|YP_002348480.1| hypothetical protein YPO3595 [Yersinia pestis CO92]
MDKKQPTLSLRVVNSDKLESGKQASSLFHTQGGSVGSDGSHHWSIQDQGGNISPSQFAIEWRDGSFCLRM
LNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVIKSHISRSAADMIDPLMVSPESLVSSYSNPMDAMMEG
EPLASPHHQQDSRLAATVSHNFSHDPLRVLETESLTTQGHDAVISDADHSLQQDRYRNPLFSSPLSDTPK
DSAMDQAFIDLPQISTFLNGKQAGGKPEGLNNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKT
LKATIEGLLALQRSQHGLRDKHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAVAESLDNLRLH
HQANQQAITQALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMYKNYYNELASSRQQGFEKLFGE
VYEQAYDRALRQGMKDSE
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|16120353|ref|NC_003143.1|:4002896-4004212 Yersinia pestis CO92 chromosome, complete genome
ATGGATAAAAAACAACCAACGCTGTCATTGCGGGTCGTCAACAGCGATAAATTAGAGAGTGGCAAACAAG
CCAGCAGCCTGTTTCATACGCAAGGGGGCAGTGTCGGCAGTGACGGTAGCCATCATTGGTCGATTCAGGA
CCAAGGCGGCAATATCAGCCCGTCACAGTTTGCTATTGAATGGCGTGATGGCTCTTTCTGCCTGCGGATG
CTGAATGGCTCTCTGAACATTAATCATTCGATGCTGACACCCAATTCGGGTTTCGTTCGCCTACAGCAAG
GGGATGAAATGACGTTGGGTAATCTGGTGATCAAAAGCCATATCAGCCGTTCTGCTGCCGATATGATCGA
TCCACTGATGGTGTCACCGGAGTCACTGGTATCGAGTTACAGCAACCCGATGGATGCCATGATGGAAGGG
GAGCCGTTGGCCTCGCCTCATCATCAGCAAGACAGCCGGTTAGCCGCGACGGTTAGCCATAATTTCAGCC
ATGATCCATTGCGGGTATTGGAAACTGAAAGCCTGACCACGCAAGGCCATGACGCCGTGATATCTGATGC
TGATCACTCTCTACAGCAGGACCGATACCGTAACCCACTTTTCTCTTCCCCGCTCTCTGATACCCCCAAG
GACAGTGCTATGGATCAGGCGTTTATCGATCTCCCGCAGATCAGTACCTTTCTTAACGGTAAACAAGCGG
GGGGCAAACCAGAAGGATTAAATAACCAAATGGAACAACATCACGTTGCCATTACGCCGCTGATGCGTGG
TTTTGACGCTCAACTCCCGATCCGCAACAGCCAGGAAGCTCACGATTTCCTTGAAGAGGCGGGTAAAACA
CTCAAAGCGACAATCGAAGGTCTGCTCGCCTTACAACGCAGCCAACATGGCTTGCGTGATAAGCACTTAC
GGCCGATTGAAGATAATCCATTGCGTCTGAATATGGATTACGACACCACCCTCAACTTGATGTTTGCCGA
TCAAAAAAGCCCGGTTCATCTTTCAGCGCCCGCCGCCGTGGCCGAAAGCCTGGATAACCTGCGTTTGCAT
CATCAGGCCAATCAACAGGCGATTACGCAAGCCTTGAACACCATGTTGGAAGCCTTCTCCCCTGAGCGTT
TACTGACGCGTTTTACCCATTATTTGCGCAGTAATGAGCGGCAAGAGCAGGACTCCGCCTGGGCGTGGGA
TATGTACAAAAACTACTATAACGAGCTGGCCTCCAGCCGCCAGCAAGGTTTTGAAAAACTGTTTGGCGAA
GTGTATGAGCAAGCCTATGACCGGGCCTTACGTCAAGGCATGAAGGATAGCGAGTAA