SecReT6
Protein ID: 218930606
SecReT6 ID22
T6SS typeN/A
Gene symbol-
Locus tagYPO3596
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]4004212..4004757 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ7CL27
KEGG IDypk:y0278, ypm:YP_3954, ype:YPO3596
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-36, Aligned region: 17..174
Protein Sequence: 181 a.a.     [Download]
>gi|218930606|ref|YP_002348481.1| lipoprotein [Yersinia pestis CO92]
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQATDQPSTVRLTLLSDPDTNPNEKGE
AVPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIA
HYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEEE
 
Nucleotide Sequence: 546 bp     [Download]
>gi|16120353|ref|NC_003143.1|:4004212-4004757 Yersinia pestis CO92 chromosome, complete genome
ATGAACAACGCCAGAGGCTATCTCCTGACGTGGGCATTATGTGTGGTGTTCCTGTTGTCTGGGTGCAGCG
GTGCATGGGAAGCCACTAAAAAGGTCGGCAAGGTGGTTATGGACCCTGATATTCCGGTGGGGCAGGCTAC
CGATCAACCCTCAACGGTCAGGCTAACATTGCTGTCCGATCCCGATACCAACCCTAATGAAAAAGGGGAA
GCGGTACCGACTGAGATAGTGGTGGTGTACCTAAGTGAAAACTCCAAGCTGCTGGCCGCGGATTATGATC
AGCTAAGCAGTGACGCGTTGGAGAAAACGCTGGGTAAGAATTACATCGATCATCAGGAATACACCTTACT
GCCCGATCAATTCAAGGCGCTGGACCCTATCAAGCTGGAAGAGAAAAACAGCTATCTGGGGGTGATTGCT
CACTATGCCGATGCCAACCGCAGTGAATGGAAGAAGATCATCAAAATAAAAGGGATCGGCCATAACTACC
AGGTTTTGGTCCATGTCAGATCAAACGATGTCGATCTAAGGAAAGAGGAAGAATAA