SecReT6
Protein ID: 218930607
SecReT6 ID22
T6SS typeN/A
Gene symbol-
Locus tagYPO3597
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]4004760..4006106 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ74PF4
KEGG IDypm:YP_3953, ype:YPO3597
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-155, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|218930607|ref|YP_002348482.1| hypothetical protein YPO3597 [Yersinia pestis CO92]
MPTKNRVIWREGLFIKPQHFQQQQRHNDYQLQRRIIALQGYSYGFSSLILNQELLKLGRIGLTVASGNMA
DGTVFDIPYQDYSPKPLDVLNCNDAASRDIYLALPMLNDAINEVAGQQGQAPGTLRYREHSDDVRDLHTE
GGDVSQLVLAQLAPRLMQGSEDLSAYSVLPLCRVKEKRPDGSLILDEEFIPTCTTLSVSTQLKGFMDEVE
GTLVERAQLLAKRIGSPGQQGIADVAEFMMLQVFNRTQPLFTHLAHQAILHPEAFYHQLVQTCGELRTFT
DESRLAGTFPVYNHDNLTDSFQPLFLAMRQALSTVLTPRAISIQLHMQAHGIRVATINDSDLLRSADFVL
AVRAQIPQEQLRRQFVQQTKITSLEKIRDLVSVQLPGVPLVALSAAPRQLPYHSGYTYFMLDLQSPVWKE
IQQSNAIAFHVSGDFPDLDMQFWAIRSS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|16120353|ref|NC_003143.1|:4004760-4006106 Yersinia pestis CO92 chromosome, complete genome
ATGCCAACCAAAAATCGAGTGATTTGGCGCGAAGGGCTGTTCATCAAACCGCAACATTTTCAACAACAGC
AACGGCATAACGACTACCAGTTACAACGCCGGATTATCGCTCTGCAAGGGTATAGCTATGGTTTCAGTTC
ACTGATCCTGAATCAGGAGTTATTGAAATTAGGGCGTATTGGCTTGACGGTCGCCAGTGGCAATATGGCT
GATGGCACGGTGTTTGATATCCCTTATCAAGACTATTCACCAAAGCCATTGGATGTACTGAATTGTAATG
ATGCGGCCAGCCGTGACATTTATCTGGCATTACCGATGCTAAACGATGCCATTAATGAGGTGGCAGGCCA
GCAGGGGCAAGCGCCGGGAACCCTTCGCTATCGTGAACATAGCGATGATGTCCGCGATTTACATACCGAA
GGGGGCGATGTCAGCCAGTTGGTACTGGCACAACTGGCACCGCGTTTGATGCAAGGCTCGGAAGACCTCA
GTGCTTACTCGGTCCTGCCGCTGTGTCGGGTCAAAGAGAAACGGCCTGACGGTTCGCTGATCTTGGATGA
AGAGTTCATTCCCACCTGCACCACGCTCAGTGTCTCCACGCAGTTAAAAGGCTTTATGGATGAAGTCGAA
GGGACATTGGTTGAACGCGCCCAACTACTGGCGAAACGTATTGGTTCTCCCGGTCAGCAGGGGATCGCGG
ATGTGGCTGAATTTATGATGTTGCAGGTCTTTAACCGGACACAGCCGCTCTTTACCCATTTGGCACATCA
GGCGATTCTGCATCCAGAAGCGTTTTACCATCAGTTGGTACAAACCTGCGGTGAACTGCGCACGTTTACC
GATGAATCACGCTTAGCGGGCACCTTCCCGGTTTATAACCACGATAACTTGACCGACAGTTTTCAGCCGT
TGTTTTTGGCGATGCGTCAGGCATTAAGCACCGTGCTCACACCGCGTGCCATCTCTATCCAGTTGCATAT
GCAGGCACACGGTATTCGCGTTGCGACCATTAATGATAGTGATCTATTGCGCAGTGCTGATTTTGTGCTG
GCGGTTCGGGCGCAAATACCTCAAGAACAATTGCGTCGGCAGTTTGTTCAGCAAACCAAAATCACCTCAC
TTGAGAAAATACGCGATTTGGTCAGTGTCCAACTGCCCGGCGTCCCGTTGGTGGCACTGTCCGCCGCACC
GCGCCAGCTCCCTTACCACTCGGGATACACCTACTTCATGCTGGATCTGCAAAGCCCTGTATGGAAAGAA
ATCCAGCAAAGCAATGCGATTGCCTTCCACGTCTCGGGTGATTTCCCTGATCTGGACATGCAATTCTGGG
CAATCAGGAGCAGCTAA