SecReT6
Protein ID: 218930608
SecReT6 ID22
T6SS typeN/A
Gene symbol-
Locus tagYPO3598
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]4006106..4006873 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ7CL28
KEGG IDype:YPO3598, ypm:YP_3952, ypk:y0276
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-63, Aligned region: 34..239
Protein Sequence: 255 a.a.     [Download]
>gi|218930608|ref|YP_002348483.1| hypothetical protein YPO3598 [Yersinia pestis CO92]
MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLGMVLRLKDMENQALPDQLYQQVVTDI
RAIEQYLQTKGYEPGAIISFRYVLCTFIDETALGHGWNTQNGWLQQSLLVHFHNETWGGEKVYVLLERLM
GEPKRYQDLLEFIYLCFCLGYRGRYKVTSQNGDDFERLFRRLHHQLQQLRGDAPPTVLYQGGGRLNSRYH
LSKRLTIKHLLWGGVSLLVVIYLFYAIHLHTQSQDILQQLNNLLS
 
Nucleotide Sequence: 768 bp     [Download]
>gi|16120353|ref|NC_003143.1|:4006106-4006873 Yersinia pestis CO92 chromosome, complete genome
ATGAAAACAGATGCTGTGACTGACAACACCCCTTTCCCCGCAGCGGAAGCGGTCACCTCCCATCGGCAGT
ATCAGCTACCGCTACGTGGCGAAAGCTTGAACGCGATGATCGATACCGCCACCCCATTATTGGGGATGGT
ACTGCGCCTGAAAGACATGGAAAACCAAGCGTTACCGGACCAGCTATATCAGCAGGTGGTGACGGATATC
CGTGCTATTGAGCAGTACTTGCAAACCAAAGGCTACGAACCCGGCGCAATCATATCTTTCCGATATGTGC
TGTGCACATTCATCGATGAAACGGCATTAGGGCATGGCTGGAACACCCAAAACGGTTGGTTACAGCAATC
TCTGTTGGTGCATTTTCATAATGAAACCTGGGGCGGAGAGAAAGTGTACGTCCTGCTGGAACGCTTAATG
GGGGAACCCAAGCGTTACCAAGACCTGCTGGAGTTTATCTATCTCTGTTTTTGTTTGGGTTACCGCGGCC
GCTACAAAGTGACATCACAAAACGGTGATGACTTTGAGCGATTGTTCCGCCGATTGCATCATCAATTACA
GCAGTTACGGGGTGATGCGCCGCCGACGGTCCTTTATCAAGGGGGCGGTCGTCTGAATAGCCGCTACCAC
TTGAGTAAACGGTTGACTATCAAGCATTTGTTATGGGGTGGCGTGAGTCTGCTGGTGGTGATTTATCTGT
TTTATGCCATCCACCTGCACACCCAAAGTCAGGATATTTTGCAACAGCTAAACAATTTATTGAGCTAG