SecReT6
Protein ID: 218930612
SecReT6 ID22
T6SS typeN/A
Gene symbol-
Locus tagYPO3602
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]4010961..4012358 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ0WB51
KEGG IDype:YPO3602
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-16, Aligned region: 56..115
Protein Sequence: 465 a.a.     [Download]
>gi|218930612|ref|YP_002348487.1| hypothetical protein YPO3602 [Yersinia pestis CO92]
MRHMDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQAMALLSQK
SKDFRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFAQQILKRFDSASSSFSQR
ADEAQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMAATPVS
PSLAIDNTSDRAWRQTLLKMADLLSEQQPDAAIGFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTAD
YLARLANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLFFTD
MTPFLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSAQLF
EKAGLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|16120353|ref|NC_003143.1|:4010961-4012358 Yersinia pestis CO92 chromosome, complete genome
GTGAGGCATATGGATATCACGTCACAACATCCCTGGCATGTCTTGTTACAAGCCCCTTTGTCACCTGAGC
AGACCGCACAAGCCCTGGCCGATGATGACCCCCAATGGGAATATATCGACGGCCAGATGGTGAAACTGGG
GTCATTGGCCCACGCCACGCTGAATATTGATGATATTCAGCAACAAGCCATGGCGCTGTTATCACAGAAA
AGTAAAGACTTCCGGCTCGTGGTGCATCTACTGCGCACCCTACAACACGGGGGCCAGCCAGATGAATTAA
TGCTGGCGATGTCGTTGCTGACCGAATACGTCCAGCTATTTTGGACTACGGCCTGGCCGCAAAATCCTTT
ACACAAACGGCGCTTTGCTCAACAAATCCTAAAACGCTTTGACAGCGCCAGCAGCAGTTTTAGCCAACGA
GCGGACGAGGCTCAACGTGAGAATGTGCAAGGATTATTGGCACATTTAGCACAGGTTTGGCATAGCCGTG
AGCCGGGTCTGGCTAAAGAGGTGGATGCATTACGCAGCCGCTATGCGCGGCCACCGGAGCGGGTTATCGA
GGCAGTGGCTTCTGATGAACCGCTCTCATCCAACACCTTGGCGGCGGCAATGGCCGCCACCCCCGTTAGC
CCAAGCCTCGCCATAGATAACACGAGCGACAGAGCCTGGCGGCAGACCTTGCTGAAAATGGCGGATCTAC
TCAGCGAACAGCAACCCGATGCCGCTATCGGTTTCCGGCTACGCCGCCATGCCGTATGGGGCGCGTTAAC
CGCACCACCTATGGCGCAGAGCGATGGCCGCACCCCGTTAGCCGCGGTATCTGCGGATCGAACCGCCGAT
TACTTAGCACGTCTGGCTAATGCCGATTTGCCTTTGTGGCACCAAGTGGAGCAGAGCCTCACCCTCGCGC
CTTATTGGCTGGATGGACATGTGCTTTCGGCACAAATCGCCCTGCAACTGGGTTATGACGCGGTGGCACA
GGCTATCCGTGATGAACTCAGCGTTTTTTTAGCCCGTATTCCCGCATTAAAAACCCTCTTTTTTACGGAT
ATGACGCCATTCCTCTCCTCTGAATCTGCCGCCTGGTTACAGCAGGATGCGAATCATCAGGGAAGAAGTC
GCACTATTGAACAGGATGAAATTTGGCAATGCTATCAACAGCAAGGATTGGAAGCCGCACTACAGATGAT
AAACCGGCAACCACAGCAATCCGAACCTCGGGACCGTTTTTACCATCAATTGCTCAGTGCACAGTTGTTC
GAAAAAGCAGGGTTAACCGCATTGGCGCAGCAGCACTACCACAGCTTATTACTGGTAGGGCAGCAATTAC
AGCTAAGCGAATGGGAACCTGCGTTGATCGCTCTACTGACAGAAAAACAGCGACAACTCAAACCATGA