SecReT6
Protein ID: 218930614
SecReT6 ID22
T6SS typeN/A
Gene symbol-
Locus tagYPO3604
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]4016048..4016830 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ74PG1
KEGG IDype:YPO3604, ypm:YP_3946
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.20E-22, Aligned region: 41..101
Protein Sequence: 260 a.a.     [Download]
>gi|218930614|ref|YP_002348489.1| hypothetical protein YPO3604 [Yersinia pestis CO92]
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDLQTAVYYTLAR
TQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERAL
QLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVRTAAAA
PEPAANIEVRSPPRRLNGGRCCGALVPVSCVVYWWRLRFTLPSSNRCNSK
 
Nucleotide Sequence: 783 bp     [Download]
>gi|16120353|ref|NC_003143.1|:4016048-4016830 Yersinia pestis CO92 chromosome, complete genome
ATGAGTGACACCCCGCAACATATCATCATTAAAACCGGCACTGACCCACGGAACCGGCCGGAATTTAACG
CCATTCGTGAAGAGATCAACAAAATCAACCACCCGGCACGGCCAGAGGTCAACTGGGGTTTGATTGAATC
ACTGGCGCTGACCCTGTTCCGCACCCACGGCGTGGATTTGCAGACGGCGGTGTATTACACGCTGGCCCGC
ACCCAAAAAAATGGCCTGGCCGGTTTCACCGAGGGCTGCGAGTTGCTGGCCGGTATGGTAGTCGGCCAGT
GGGATCACCTGTGGCCGGAACAGCCGCAGGCACGCAGTGAAATACTGGAATGGTTCAATACCCGCGTCAG
CAATCAACTGCGTCAGCATGATTTTACCCGTGACGATCTGCGGCTGGTGTACCGCGCCGAGCGGGCCTTG
CAGTTGCTGTACGATAAATTGCAACAGGTTGAATTAAAACGGGTACCGCGCATTGAAAACTTGCTGTACC
TGATGCAGAACACCGCCAAAAAACTCGAATCGGCCAGTGATGCGGCGAAGGCTCAGCAAACCGCGGCCCC
GCTGAAAATGCCGCCTATGGTCTATCTCTCGGTACCCGAGGCCGAGCCTGTCCGGACGGCAGCGGCAGCC
CCTGAGCCTGCGGCCAATATTGAGGTGCGTTCGCCCCCCCGGCGACTAAACGGGGGGCGGTGCTGTGGGG
CTTTGGTGCCGGTGTCCTGTGTAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGTTCAAACCGCTG
CAACAGCAAATGA