SecReT6
Protein ID: 218930618
SecReT6 ID22
T6SS typeN/A
Gene symbol-
Locus tagYPO3608
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]4020241..4023105 [+]
Producthypothetical protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 365..391
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 401..437
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 474..499
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 488..524
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 531..567
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 595..619
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 638..671
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 662..695
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 701..730
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 722..757
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 766..796
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 808..823
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 814..823
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 865..901
RHS_repeat [PF05593], Evalue: 2.80E-44, Aligned region: 939..953
PAAR_motif [PF05488], Evalue: 5.90E-12, Aligned region: 79..149
DUF4595 [PF15283], Evalue: 0.0021, Aligned region: 103..136
DUF4595 [PF15283], Evalue: 0.0021, Aligned region: 371..406
DUF4595 [PF15283], Evalue: 0.0021, Aligned region: 419..496
DUF4595 [PF15283], Evalue: 0.0021, Aligned region: 655..681
DUF4595 [PF15283], Evalue: 0.0021, Aligned region: 736..767
Protein Sequence: 954 a.a.     [Download]
>gi|218930618|ref|YP_002348493.1| hypothetical protein YPO3608 [Yersinia pestis CO92]
MFEAARVDDKLYHSSALAGFIIGSIIGAAVIFAAAAYAASIVLTGGATLVATGFIVGMGVTTLGVVAGGL
IRSVGEKIGSMCHHDVGQITTGSKNVKVNSKRAAHVELSTVACKDDSAIQRMAEGSSNIFINSKAAVRLE
DKTTCDAVVDSASSNVTFGGGRVQYLDIKREISDEMRDLSEKLFIVAGLAGGIFGAAKQAGCFGLKCLSK
IALGEMAGAAAGYGLEKGVGAIAGYFGYPVDVISGQKLLTGEGDDTDFILPGIFPLHWSRIYRSENHHVG
ALGQGWSLVWERSLRKEDDSIVYQNDEGREIVFPLIKRGERYFSPTEHIWLARTERDTYAISSPFETCFI
FEAFSEAGVAKLASLEDLNGHALYFSYDDIGQLKKISTTSGYGVYCQYEKGRLVSVACVKGGTPGTLVRY
QYNEQHQLVSVTNREGQITRQFGYHGHLINKLADVRGLECRYTWADIGGTPRITHSATNLGEQWQFDYDI
DNQQTTLTDLNTGQTACWGYNAQHLITDYRDFDGGKYAFDYNDLNMPVRVVLAGERTLVLVYDALARPIQ
ITDPLKRETHIDYHRNSLRVVRRQYPDGQVWKGEYDRTGRLLKENAPDGGVTLYHYPGASSLPERITNAV
GAQTHLGWERHGQLTEHTDCSGKLTRYEYDIDGHLLTVIDAENHSTHYSYNRLGQPTGIRYADGRKEQLR
YNAQGLVEQFTDPVGRQLHWRYNLRGQPVSFTDRLQREYRYRYDCHGQMIELDNANGGQYHFRWSSGGQL
VEEQYPDNLVRRYRYGESGMLMALETTAPTVDDLTVSRQVSFDYDAGGRMTQRLTGMSATRYDWDIMDRL
LLAERVPTAVGEQAGIVGHGVRLAYDKAGHLLTESGDLGAVTYQWDPLHHLAALTLPDGQTLSWLRYGAG
HVSAIRHGDTLISEFSRDNLHREVSRTQGILTQYRDYDAMGRRL
 
Nucleotide Sequence: 2865 bp     [Download]
>gi|16120353|ref|NC_003143.1|:4020241-4023105 Yersinia pestis CO92 chromosome, complete genome
ATGTTTGAAGCGGCCCGTGTTGATGACAAGCTTTATCATTCCAGTGCCTTAGCGGGTTTTATTATTGGCT
CCATTATTGGTGCCGCCGTGATTTTTGCGGCCGCGGCTTACGCCGCCTCCATTGTTCTCACCGGCGGGGC
GACGCTGGTCGCTACCGGCTTTATTGTGGGTATGGGGGTGACCACGCTGGGCGTCGTTGCCGGTGGGTTA
ATACGCTCCGTGGGCGAAAAAATAGGGAGCATGTGCCATCACGATGTCGGACAAATTACGACAGGGTCCA
AAAACGTTAAAGTGAACAGTAAACGGGCGGCGCATGTCGAGCTCAGTACCGTGGCCTGTAAAGATGACTC
CGCCATTCAGCGCATGGCCGAAGGTTCGTCAAATATCTTTATTAACAGTAAAGCCGCCGTTCGTCTGGAA
GATAAAACGACCTGTGATGCGGTTGTCGATTCCGCTTCCAGTAATGTGACGTTTGGTGGGGGGCGCGTTC
AGTATCTCGATATTAAACGCGAGATTTCTGATGAAATGCGTGATTTGTCAGAGAAGCTGTTTATTGTCGC
CGGGCTGGCGGGCGGCATATTTGGGGCGGCAAAACAGGCGGGGTGTTTCGGCCTTAAATGCCTGAGCAAG
ATTGCGTTGGGTGAGATGGCCGGGGCGGCTGCCGGGTATGGGTTGGAAAAAGGGGTTGGGGCCATCGCCG
GTTATTTCGGTTACCCGGTTGATGTGATCAGTGGACAGAAATTGCTGACAGGTGAGGGCGATGATACCGA
TTTTATTCTGCCGGGTATCTTCCCGCTGCACTGGAGCCGGATTTATCGCAGTGAAAATCACCATGTCGGG
GCGCTGGGACAAGGCTGGTCTCTGGTATGGGAGCGTTCATTACGCAAAGAAGATGACAGCATTGTTTATC
AGAATGATGAAGGTCGGGAGATTGTCTTTCCCCTGATTAAACGTGGAGAGCGCTATTTCTCCCCCACGGA
GCATATCTGGCTGGCACGTACCGAGCGTGATACCTATGCCATCAGCAGCCCGTTTGAAACCTGTTTTATT
TTTGAGGCCTTTTCTGAGGCTGGCGTTGCGAAATTAGCCAGCCTCGAAGATCTCAATGGTCATGCCCTGT
ATTTCTCTTATGACGATATCGGGCAACTGAAAAAAATATCGACCACCAGCGGTTATGGGGTGTATTGCCA
GTATGAAAAAGGGCGTCTGGTGTCCGTTGCCTGCGTCAAGGGCGGTACGCCGGGCACACTGGTCCGCTAC
CAGTATAATGAACAGCACCAGTTGGTCAGCGTCACTAACCGTGAGGGGCAAATCACCCGCCAGTTTGGTT
ACCATGGCCATCTGATCAATAAACTGGCGGATGTCAGGGGGCTGGAGTGCCGTTACACATGGGCTGATAT
CGGCGGAACCCCGCGAATTACGCACAGTGCCACCAATCTGGGGGAGCAGTGGCAGTTTGATTATGATATC
GACAATCAACAGACCACCCTGACGGACCTCAATACCGGGCAGACCGCCTGCTGGGGATATAACGCCCAAC
ATTTAATTACCGACTATCGGGATTTTGATGGCGGGAAATATGCATTTGACTACAACGACCTCAATATGCC
GGTACGCGTTGTGCTGGCAGGCGAGAGAACGCTCGTTCTGGTTTACGATGCACTGGCGCGCCCGATCCAG
ATCACCGATCCGCTAAAACGTGAAACCCACATTGATTATCACCGTAACAGTCTGCGGGTGGTGCGCCGTC
AGTACCCTGACGGGCAGGTCTGGAAGGGGGAATATGACCGTACCGGCCGTTTGCTGAAAGAGAACGCGCC
GGATGGCGGGGTGACGCTTTATCATTATCCAGGGGCCTCATCCCTTCCTGAACGCATAACCAATGCCGTA
GGGGCGCAGACACACCTTGGTTGGGAAAGGCACGGGCAACTGACGGAGCACACCGACTGCTCGGGTAAAC
TGACCCGCTACGAATATGATATCGATGGCCATCTGCTGACGGTCATCGATGCTGAAAACCATTCAACACA
TTACAGCTACAACCGTCTCGGGCAGCCCACCGGGATCAGGTACGCCGATGGCCGCAAAGAGCAGTTGCGG
TATAACGCTCAGGGGCTGGTTGAACAGTTTACCGATCCTGTCGGGCGGCAGTTGCACTGGCGTTATAACC
TGCGGGGTCAGCCGGTCAGCTTTACTGATCGTCTGCAACGGGAATACCGTTACCGCTATGACTGCCATGG
GCAGATGATTGAGCTGGATAATGCCAATGGTGGCCAGTATCACTTCCGGTGGAGCAGTGGCGGGCAATTG
GTGGAAGAGCAGTATCCCGATAACCTTGTCCGGCGTTATCGCTATGGGGAGAGCGGGATGCTGATGGCGC
TGGAGACCACCGCGCCCACGGTTGACGATCTTACCGTCTCCCGGCAGGTCAGTTTTGACTATGATGCGGG
CGGGCGAATGACGCAGCGCCTGACGGGCATGAGTGCGACCCGGTATGACTGGGACATCATGGACCGTTTA
TTGCTGGCCGAGCGTGTGCCAACGGCGGTGGGCGAACAGGCGGGGATCGTCGGTCATGGTGTTCGTTTGG
CGTATGACAAGGCCGGGCATTTACTGACGGAAAGCGGTGACCTGGGTGCGGTGACGTATCAGTGGGATCC
GCTGCATCATCTGGCCGCCCTGACGCTGCCCGATGGTCAGACGCTGTCATGGTTGCGTTACGGTGCGGGC
CATGTCAGTGCCATTCGTCATGGTGATACGCTTATTTCCGAGTTCAGCCGGGATAATCTTCATCGGGAAG
TGAGCCGGACCCAGGGTATTTTGACGCAGTATCGTGATTATGACGCGATGGGGCGGCGGTTGTAG