SecReT6
Protein ID: 220922974
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3031
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3122524..3123006 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDB8IIA4
KEGG IDmno:Mnod_3031
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-43, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|220922974|ref|YP_002498276.1| type VI secretion system effector [Methylobacterium nodulans ORS 2060]
MAVDIFLKLEGIKGEAQDAKHKDEIDILSWSWGMSQSGTTHMGSGSGSGKVSVQDISLTKYIDKASPTLA
QHCANGKHITKGTLIVRKAGDKPLEYIVIELKDIIVSHVSLGGTSHDDRLHESITLNFREFDYKYTTQAA
NGSAGPQTEVKWDIAKNVAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|220920054|ref|NC_011894.1|:c3123006-3122524 Methylobacterium nodulans ORS 2060 chromosome, complete genome
ATGGCTGTCGATATCTTTCTGAAGCTCGAAGGGATCAAGGGCGAAGCGCAGGACGCCAAGCACAAGGACG
AGATCGACATTCTGTCGTGGTCCTGGGGCATGTCCCAGTCGGGGACAACGCATATGGGTTCGGGGTCCGG
CTCCGGTAAAGTGTCGGTGCAGGACATCAGCCTGACCAAGTACATCGACAAGGCCTCGCCAACGCTCGCC
CAGCACTGCGCCAACGGCAAGCACATCACCAAGGGCACGCTCATCGTACGCAAGGCGGGCGACAAGCCGC
TCGAATACATCGTCATTGAACTCAAGGACATTATCGTCTCGCATGTCTCTTTGGGCGGCACCTCGCACGA
CGATCGCCTGCACGAGAGCATCACGCTCAACTTCCGTGAATTCGACTACAAGTACACGACCCAGGCAGCG
AACGGCTCCGCCGGTCCTCAGACCGAGGTCAAATGGGACATCGCGAAGAACGTCGCGGCGTGA