SecReT6
Protein ID: 220922978
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3036
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3126081..3128792 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDB8IIA8
KEGG IDmno:Mnod_3036
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.60E-40, Aligned region: 228..248
AAA_2 [PF07724], Evalue: 5.60E-40, Aligned region: 612..781
AAA [PF00004], Evalue: 6.90E-21, Aligned region: 228..331
AAA [PF00004], Evalue: 6.90E-21, Aligned region: 618..702
AAA [PF00004], Evalue: 6.90E-21, Aligned region: 804..861
AAA_5 [PF07728], Evalue: 2.00E-13, Aligned region: 228..248
AAA_5 [PF07728], Evalue: 2.00E-13, Aligned region: 302..358
AAA_5 [PF07728], Evalue: 2.00E-13, Aligned region: 617..735
ClpB_D2-small [PF10431], Evalue: 1.20E-11, Aligned region: 527..562
ClpB_D2-small [PF10431], Evalue: 1.20E-11, Aligned region: 789..864
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 27..79
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 206..247
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 273..306
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 442..506
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 608..662
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 683..703
AAA_16 [PF13191], Evalue: 1.50E-10, Aligned region: 774..868
AAA_22 [PF13401], Evalue: 4.70E-09, Aligned region: 37..82
AAA_22 [PF13401], Evalue: 4.70E-09, Aligned region: 227..324
AAA_22 [PF13401], Evalue: 4.70E-09, Aligned region: 616..697
Sigma54_activat [PF00158], Evalue: 1.90E-07, Aligned region: 222..245
Sigma54_activat [PF00158], Evalue: 1.90E-07, Aligned region: 617..733
AAA_19 [PF13245], Evalue: 2.10E-06, Aligned region: 228..250
AAA_19 [PF13245], Evalue: 2.10E-06, Aligned region: 615..639
IstB_IS21 [PF01695], Evalue: 6.80E-06, Aligned region: 211..250
IstB_IS21 [PF01695], Evalue: 6.80E-06, Aligned region: 617..637
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 64..97
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 223..289
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 526..556
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 614..644
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 677..700
AAA_14 [PF13173], Evalue: 3.80E-05, Aligned region: 228..308
AAA_14 [PF13173], Evalue: 3.80E-05, Aligned region: 616..698
Zeta_toxin [PF06414], Evalue: 5.80E-05, Aligned region: 222..248
Zeta_toxin [PF06414], Evalue: 5.80E-05, Aligned region: 608..667
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 219..249
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 615..642
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 228..242
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 616..653
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 208..245
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 279..311
Arch_ATPase [PF01637], Evalue: 0.00022, Aligned region: 616..651
NACHT [PF05729], Evalue: 0.00036, Aligned region: 228..255
NACHT [PF05729], Evalue: 0.00036, Aligned region: 617..645
AAA_18 [PF13238], Evalue: 0.0013, Aligned region: 228..243
AAA_18 [PF13238], Evalue: 0.0013, Aligned region: 618..646
AAA_30 [PF13604], Evalue: 0.0035, Aligned region: 223..250
AAA_30 [PF13604], Evalue: 0.0035, Aligned region: 616..646
NTPase_1 [PF03266], Evalue: 0.004, Aligned region: 228..249
NTPase_1 [PF03266], Evalue: 0.004, Aligned region: 280..304
NTPase_1 [PF03266], Evalue: 0.004, Aligned region: 448..502
NTPase_1 [PF03266], Evalue: 0.004, Aligned region: 617..638
RNA_helicase [PF00910], Evalue: 0.0047, Aligned region: 229..249
RNA_helicase [PF00910], Evalue: 0.0047, Aligned region: 618..639
DUF815 [PF05673], Evalue: 0.0093, Aligned region: 212..303
DUF815 [PF05673], Evalue: 0.0093, Aligned region: 616..658
Protein Sequence: 903 a.a.     [Download]
>gi|220922978|ref|YP_002498280.1| type VI secretion ATPase, ClpV1 family [Methylobacterium nodulans ORS 2060]
MTEISIETVTGKLNRVGYDAFIQALRAARAAGHRNVELAHWLARLLDARDSDLSLTVDHYGLDRGRLSAD
LARALESLRRGGTELPGVAPSIIDALDRGWHQATLLFGETQIRSGHLLVGALRSGELRRALLALSPEFGR
LPVDALVANHRAIWACSEEENLQPMDGAGLVAGSSDAAGPAGRTALDRFSQDLTARAARGDMDPVRGRDE
EIRQVTDVLMRRRQNNPILTGEAGVGKTAVVEGFAQAVVAGRVPPTLREVRVCALDIGLMQAGASMKGEF
EQRLRAVIDEVQSSPKPIILFIDEAHTLIGAGGQAGTGDAANLLKPALARGGLRTIAATTWAEYRQHIEK
DPALTRRFQPIHIGEPGIDQCRDMVRGLIGVMETHHGVRIAEAAIAAAVRLSHRYIPSRQLPDKAVSLLD
TACARVAVSQNAVPAAVEDARAAIRALEDERAALSADRDLGRDSSQRLNAIATELATAQEGLADLEAAWA
EQVALVEEIGTLRRRREAPAAPPDGITPAGEICAALQSLTERLDAIPPERRMVHAHVDEGTVAAIVSDWT
GIPVGRMVRDEIETVLRLPEIIGARVVGQSHGLAMIARRVETNRAGLENPNKPVGVFLLCGPSGVGKTET
ALALAEALYGGEQNLITINMSEFQEAHTVSTLKGAPPGYVGHGEGGRLTEAVRRRPYSVVLLDEIEKAHP
DVHELFFQVFDKGVMEDGTGRRIDFRNTLILMTSNVGTDLIMRAAPRADCAPHGESFAEAIAEALRPELL
RVFPAALLGRIVTIPYLPLSPAMLEAIIRLQLDRIGARVRAAHGVAFSYDATVVTDILARCDDPDSGGRM
IDNIVTNTLLPDLSRALLNRALARTSARAVRVTVADGAFVYAWDNAAPDAGPAEPTARVHEAA
 
Nucleotide Sequence: 2712 bp     [Download]
>gi|220920054|ref|NC_011894.1|:c3128792-3126081 Methylobacterium nodulans ORS 2060 chromosome, complete genome
ATGACCGAGATCAGCATCGAGACCGTCACCGGCAAGCTCAACCGCGTCGGTTACGACGCCTTCATCCAGG
CCCTGCGCGCCGCCCGGGCGGCAGGCCACCGCAACGTCGAACTCGCGCACTGGCTCGCGCGGCTCCTCGA
CGCGCGCGACAGCGACCTGTCCCTGACGGTCGACCATTACGGCCTCGACCGCGGGCGCCTCTCGGCCGAC
CTCGCCCGCGCGCTGGAGAGCTTGCGGCGGGGTGGGACCGAGCTGCCGGGCGTGGCGCCCTCGATCATTG
ATGCCCTCGACCGCGGCTGGCACCAGGCGACGCTCTTGTTCGGCGAGACGCAGATCCGCTCCGGCCACCT
CCTCGTCGGCGCCCTGCGCTCGGGCGAACTGCGCCGCGCCCTCCTCGCCCTCTCGCCCGAGTTCGGCCGC
CTCCCGGTCGACGCGCTCGTCGCAAATCATCGCGCCATCTGGGCCTGCTCAGAGGAGGAGAACCTGCAGC
CGATGGACGGAGCTGGCCTCGTCGCCGGCTCTTCTGACGCGGCGGGGCCGGCGGGCCGCACGGCGCTCGA
TCGCTTCTCGCAGGACCTCACGGCTCGGGCGGCCCGCGGCGACATGGATCCCGTGCGCGGTCGCGACGAG
GAGATTCGGCAGGTTACGGACGTGCTCATGCGGCGGCGGCAGAACAACCCGATCCTCACTGGCGAGGCGG
GAGTCGGCAAGACCGCCGTGGTCGAAGGCTTCGCGCAGGCCGTCGTGGCCGGCCGCGTGCCACCCACGCT
CCGGGAGGTGCGCGTCTGTGCCCTCGATATCGGCCTCATGCAGGCCGGCGCGTCGATGAAGGGCGAGTTC
GAACAGCGGCTGCGCGCCGTGATCGACGAGGTGCAATCCTCGCCCAAGCCCATCATCCTGTTCATCGATG
AGGCGCACACCCTCATCGGCGCGGGAGGCCAAGCCGGAACCGGGGACGCGGCAAATCTGCTCAAGCCGGC
GCTCGCACGCGGCGGCCTGCGCACGATCGCGGCGACCACCTGGGCGGAGTACCGTCAGCACATCGAGAAG
GATCCCGCGCTCACCCGCCGCTTCCAGCCGATCCACATCGGCGAGCCCGGGATCGACCAATGCCGTGACA
TGGTGCGCGGGCTTATCGGGGTAATGGAAACGCATCATGGCGTGCGCATCGCCGAGGCTGCCATCGCGGC
GGCCGTCCGGCTCTCTCACCGCTACATCCCGTCTCGGCAGCTTCCTGACAAGGCGGTCAGCCTGCTCGAC
ACGGCCTGCGCGCGCGTCGCCGTGAGTCAGAACGCAGTTCCCGCAGCGGTCGAGGATGCGCGCGCCGCGA
TCCGGGCTCTCGAGGACGAGCGCGCGGCGCTGTCAGCCGACCGCGACCTCGGCCGCGACAGCAGCCAACG
CCTGAATGCTATTGCGACCGAACTCGCGACCGCGCAGGAGGGCCTCGCCGACCTGGAGGCCGCCTGGGCC
GAGCAGGTCGCCCTCGTGGAGGAGATCGGGACGCTGCGCCGGCGGCGGGAGGCGCCCGCCGCCCCACCTG
ATGGAATCACTCCGGCCGGTGAGATCTGCGCCGCCTTGCAGTCCCTCACCGAGCGCCTCGACGCGATTCC
GCCGGAGCGCCGGATGGTGCACGCCCACGTGGATGAGGGGACAGTCGCCGCGATCGTGTCCGATTGGACC
GGAATTCCGGTCGGGCGGATGGTGCGCGACGAGATCGAGACGGTGCTGCGCCTGCCGGAAATCATCGGGG
CCCGCGTGGTGGGCCAGTCGCACGGCCTGGCGATGATCGCCCGCCGTGTCGAGACGAACCGTGCGGGCCT
GGAGAATCCGAATAAGCCTGTCGGGGTCTTCCTGCTCTGCGGTCCGTCGGGCGTCGGCAAGACTGAGACG
GCCCTCGCGCTCGCCGAAGCCCTGTACGGCGGCGAGCAGAACCTGATCACGATCAACATGAGCGAGTTCC
AGGAGGCGCACACAGTGTCGACCCTGAAGGGTGCGCCGCCTGGCTATGTCGGGCACGGCGAGGGCGGGCG
GCTCACCGAAGCCGTGCGGCGCCGGCCCTACAGCGTAGTTCTGCTCGACGAGATCGAGAAGGCCCATCCG
GATGTCCACGAGCTGTTCTTCCAAGTCTTCGATAAGGGTGTCATGGAGGACGGCACGGGGCGGCGGATCG
ACTTCCGCAACACGCTCATCCTCATGACCTCGAACGTCGGCACCGACCTGATCATGCGCGCCGCGCCGCG
TGCGGACTGCGCACCTCATGGGGAGAGCTTCGCCGAGGCGATTGCGGAGGCGCTGCGGCCAGAGCTGCTG
CGCGTCTTCCCCGCCGCCCTCCTCGGCCGGATCGTAACCATTCCCTACCTGCCCCTCTCGCCCGCGATGC
TCGAGGCCATTATCCGCCTCCAGCTTGATCGGATCGGAGCGCGGGTCCGCGCGGCACATGGCGTCGCCTT
CTCCTACGACGCCACCGTCGTTACCGACATCCTGGCGCGCTGCGACGACCCGGATTCTGGCGGCCGGATG
ATCGACAACATCGTCACGAACACTCTGCTCCCCGACCTCTCGCGCGCACTCCTGAACCGGGCGCTCGCCC
GGACGAGCGCGCGGGCCGTGCGGGTCACGGTCGCGGACGGCGCCTTCGTCTACGCATGGGACAACGCGGC
GCCCGACGCAGGCCCGGCGGAGCCGACGGCCCGCGTGCACGAGGCCGCCTGA