SecReT6
Protein ID: 220922979
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3037
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3128789..3129946 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB8IIA9
KEGG IDmno:Mnod_3037
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-99, Aligned region: 47..346
Protein Sequence: 385 a.a.     [Download]
>gi|220922979|ref|YP_002498281.1| type VI secretion protein [Methylobacterium nodulans ORS 2060]
MSAAALLAAGTAPAEAAATEAPPRAARPAPPPASAPHTAPVSPALAARPGAHDLFALLRRLEREHPDRPR
IGDSAARREEYVALGEDPFLDFPASTLSRVDRDADGRLRLFVRFLGLLGPQGALPLAVTDEAHGWHLAHD
DAFPRFLDILNNRFLQLFFRAWADARPAAQADRPDQDRFVAYVGSAIGLGSAPYRNRGAVPDSAKLAFAG
LLAPKAKSPARLRAAVAGLFGVAVEIDSFVGTQLAFEPGDRSRLGRAHARLGADLLLGSRVFSVEDRFRI
RIIAADLAQYERFLPTGESCALLADLVFFHLGEELDWELELALPAHAVRPARLGRGGRLGYTAWITRPPD
PDAPGLRRDARLNPAERIRVLEAHPNPHRTDRRPS
 
Nucleotide Sequence: 1158 bp     [Download]
>gi|220920054|ref|NC_011894.1|:c3129946-3128789 Methylobacterium nodulans ORS 2060 chromosome, complete genome
GTGAGCGCCGCCGCTCTCCTCGCGGCCGGCACCGCGCCCGCCGAAGCCGCGGCGACCGAGGCTCCGCCCC
GGGCGGCCCGCCCCGCCCCGCCTCCGGCCTCCGCGCCGCACACGGCCCCCGTGTCGCCCGCGCTCGCGGC
GCGGCCCGGCGCGCACGACCTCTTCGCGCTGCTGCGGCGTCTGGAGCGCGAGCATCCCGACCGGCCGCGG
ATCGGCGACAGTGCAGCGCGGCGCGAGGAATACGTCGCGCTCGGGGAGGATCCTTTTCTCGACTTCCCCG
CCTCCACGCTCTCGCGCGTCGACCGCGACGCGGACGGGCGCCTGCGGCTCTTCGTGCGGTTCCTCGGGCT
CCTCGGCCCACAGGGAGCACTGCCGCTCGCCGTGACGGACGAGGCGCATGGCTGGCATCTTGCGCATGAC
GACGCCTTCCCGCGCTTCCTCGACATCCTCAACAACCGCTTCCTGCAGCTCTTCTTTCGCGCCTGGGCGG
ATGCGCGGCCCGCCGCTCAGGCCGACCGGCCGGACCAGGACCGCTTCGTCGCCTATGTGGGCTCCGCGAT
CGGGCTGGGTTCGGCGCCCTACCGCAACCGGGGCGCAGTGCCGGATTCGGCCAAGCTCGCCTTCGCGGGC
CTGCTCGCCCCGAAGGCGAAGTCGCCGGCGCGGCTGCGCGCGGCGGTGGCCGGGCTGTTCGGGGTCGCGG
TCGAGATCGACTCCTTCGTCGGCACGCAGCTCGCCTTCGAGCCCGGCGACCGCTCCCGCCTCGGGCGCGC
CCATGCGCGGCTCGGCGCGGACCTCCTCCTCGGGAGCCGCGTGTTCAGCGTCGAGGACAGGTTCCGCATC
CGGATCATCGCGGCGGATCTCGCCCAGTACGAGCGCTTCCTGCCGACGGGCGAATCCTGCGCGCTGCTCG
CCGACCTCGTCTTCTTCCACCTCGGCGAGGAACTCGACTGGGAGCTCGAACTCGCGCTGCCGGCGCACGC
GGTGCGGCCCGCCCGCCTCGGGCGCGGGGGGCGGCTCGGCTACACCGCCTGGATCACCCGCCCGCCGGAT
CCCGACGCCCCCGGCCTGCGCCGGGACGCCCGGCTCAATCCCGCCGAACGCATCCGGGTCCTTGAGGCCC
ACCCCAACCCCCACCGCACCGACAGGAGGCCGTCATGA