SecReT6
Protein ID: 220922980
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3038
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3129943..3131886 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB8IIB0
KEGG IDmno:Mnod_3038
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-175, Aligned region: 5..646
Protein Sequence: 647 a.a.     [Download]
>gi|220922980|ref|YP_002498282.1| type VI secretion protein [Methylobacterium nodulans ORS 2060]
MNREFLDLYNRELGVLNEDARAFAQEYPGIAERLGGLVEDRADPMIAGLLEGAAFLAARVQLKLKHEFPE
FTASLLEQLVPHYLAPTPSVLLARIGAPYGDPALRAGRRIARGAILDAAYSERERRVACRYRLTRDVVLW
PFAITAAEYCATPAGLSALGLPVEADVAAGLRLTLTHRTAADPAQEEGADPEAASIAGCAVDDLPVHLVG
PEADAVAIYEALFSASARVAFRVLDAFGDPVVVPAPPGCLAPVGFEREEALLPNDLRVFEGFDLLREYFM
FPRKFLGFRLTGLREVLPRLTARSVDVIVTFRECNARLAAAVRPEAFALYAAPAVNLFEMTTDRVPVRAG
EHEHHLVPDRSRMLDFEPHRVLDVYAHVAGRSEKRRVEPLHAAQGAARATGPSYTLRRLPRRRSSAERQA
AQTSDYCGTEIFLTLVDSAREDEERIAELSVRALCSNRHLPEHLPVGAGGTDFRLADDADLEVLCVAGPT
RPREPVVAQMRGRAGTAWTGEVAWRLVNMLSLNHLGLVRRGAGASAEALREMLSLFADLSDAAVERRIRG
VRSVDSRPVVRRLRQRLGTGTARGTEVTVTLDERAFEGTGAFLLGAVLDRFYAEYAGINHFTQTVIRTTD
RGEIMRWPPRAGARAPL
 
Nucleotide Sequence: 1944 bp     [Download]
>gi|220920054|ref|NC_011894.1|:c3131886-3129943 Methylobacterium nodulans ORS 2060 chromosome, complete genome
ATGAACCGGGAATTCCTCGACCTCTACAACCGCGAACTCGGCGTCCTGAACGAGGACGCGCGTGCCTTCG
CGCAGGAATATCCGGGCATCGCGGAACGCCTCGGCGGCCTCGTCGAGGACCGCGCCGACCCGATGATCGC
CGGCCTCCTCGAAGGCGCGGCGTTCCTGGCCGCGCGCGTGCAGCTCAAGCTCAAGCACGAATTCCCCGAA
TTCACCGCGAGCCTGCTCGAACAGCTCGTGCCGCACTACCTCGCGCCGACGCCCTCGGTGCTGCTCGCCC
GAATCGGGGCGCCCTACGGCGACCCGGCCCTGCGCGCCGGGCGCCGGATCGCCCGCGGGGCGATCCTGGA
TGCCGCCTACAGCGAGCGCGAGCGCCGGGTCGCCTGCCGCTACCGCCTGACGCGCGACGTGGTGCTGTGG
CCCTTCGCGATCACCGCCGCGGAGTACTGCGCGACCCCGGCGGGCTTGAGCGCGCTCGGCCTCCCGGTCG
AGGCGGACGTCGCGGCGGGCCTGCGCCTGACGCTGACGCACCGCACCGCCGCCGATCCGGCGCAGGAGGA
GGGCGCGGACCCGGAGGCCGCCTCGATCGCGGGGTGCGCCGTCGACGACCTGCCGGTCCACCTCGTCGGC
CCGGAGGCGGACGCGGTCGCGATCTACGAGGCGCTGTTCTCGGCCTCCGCGCGCGTCGCCTTCCGGGTGC
TCGACGCCTTCGGGGACCCGGTCGTGGTGCCGGCGCCGCCCGGCTGCCTCGCGCCAGTCGGCTTCGAGCG
CGAGGAGGCGCTGCTGCCGAACGACCTGCGGGTCTTCGAGGGCTTTGATCTCCTGCGCGAGTACTTCATG
TTCCCGCGCAAGTTCCTGGGCTTCCGCCTCACCGGCCTGCGCGAGGTGCTGCCGCGGCTCACGGCGCGCA
GCGTCGACGTGATCGTGACCTTCCGGGAGTGCAATGCCCGCCTCGCCGCGGCCGTGCGGCCGGAGGCCTT
CGCGCTCTATGCGGCGCCGGCCGTCAACCTGTTCGAGATGACGACGGACCGCGTGCCGGTGCGGGCCGGC
GAGCACGAGCACCACCTCGTGCCCGACCGCAGCCGCATGCTCGACTTCGAGCCGCACCGCGTGCTCGACG
TCTACGCCCACGTCGCGGGCCGGTCCGAGAAGCGCCGGGTCGAGCCGCTGCACGCGGCGCAGGGCGCCGC
GCGGGCGACGGGCCCATCCTATACTCTACGCCGCCTGCCGCGCCGCCGCTCGTCGGCAGAGCGGCAGGCG
GCGCAGACCTCGGATTACTGCGGGACCGAGATCTTCCTCACCCTCGTCGACTCGGCGCGCGAGGACGAGG
AGCGCATCGCCGAACTCAGCGTGCGGGCGCTCTGCTCGAACCGGCACCTGCCCGAGCACCTGCCGGTCGG
GGCGGGCGGCACCGACTTCCGCCTCGCGGACGACGCCGACCTGGAGGTGCTGTGCGTCGCCGGCCCGACG
CGCCCGCGCGAGCCCGTGGTGGCGCAGATGCGCGGCCGGGCCGGGACCGCCTGGACCGGCGAGGTGGCGT
GGCGCCTCGTGAACATGCTGAGCCTCAACCACCTCGGGCTGGTGCGCCGCGGGGCGGGGGCGAGCGCCGA
GGCGCTGCGGGAGATGCTGTCGCTCTTCGCCGACCTCTCCGACGCGGCGGTGGAGCGCCGCATCCGCGGC
GTGCGCAGCGTCGACAGCCGCCCGGTGGTGCGGCGGCTGCGCCAGCGCCTCGGCACCGGCACGGCGCGCG
GCACCGAAGTGACCGTCACTCTCGACGAGCGCGCCTTCGAGGGCACCGGCGCCTTCCTGCTCGGCGCCGT
GCTCGACCGCTTCTACGCCGAATATGCCGGGATCAACCACTTCACCCAGACCGTGATCCGCACGACGGAC
CGCGGCGAGATCATGCGCTGGCCGCCCCGGGCCGGCGCGAGGGCGCCGCTGTGA