SecReT6
Protein ID: 220922982
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3040
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3132492..3134012 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB8IIB2
KEGG IDmno:Mnod_3040
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-183, Aligned region: 73..502
Protein Sequence: 506 a.a.     [Download]
>gi|220922982|ref|YP_002498284.1| EvpB family type VI secretion protein [Methylobacterium nodulans ORS 2060]
MSLDAVERASARDLAPAPPPGMPDADEFKALLKQSFRPRTERAATEVENAVSTLVSQALADASLVKDDVL
DTIEEMIARIDEKLTAQVNAILHAPEFQKMESAWRGLHYLVFNSETDATLKIRVMNVSKSELSRNLKLFP
GARWDQSPLFKKVYEAEFGQLGGEPFGCLIADYHFSHVPTDIQLLRDLSKIAGSAHAPFFAGADPALLGM
DSFTELANPRDLGKIFETPDYGPWKSLRDAPDARYLGLCMPRVLARLPYGAKTEPVEEFAFEEETDGHAG
EAYAWMNAAYAMAVNINRSYKENGWTVRIRGVQSGGEVVNLPNHTFPTDDGGVDLKCPTEIAISDRREAE
LAKAGLIPLIHRKNTDKAAFIGAQSVYRPKTYFGEKGVEATASDNLSARLPYIFAVSRFAHYLKCMVRDK
IGSTKEKDQLTKWLQEWINQYVDGDPTNSSEQTKARKPLADARVDIFEDEENPGYYSAKFYLRPHYQLEG
MDIGMSLVSRLPAPKE
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|220920054|ref|NC_011894.1|:c3134012-3132492 Methylobacterium nodulans ORS 2060 chromosome, complete genome
ATGTCCCTCGACGCCGTCGAGCGCGCCTCCGCGCGCGACCTCGCCCCCGCTCCGCCCCCCGGGATGCCCG
ACGCGGACGAGTTCAAGGCCCTGCTCAAGCAGAGCTTCCGGCCGCGCACCGAGCGCGCCGCCACCGAGGT
GGAGAACGCCGTCTCCACCCTCGTCTCTCAGGCGCTCGCGGACGCGAGCCTCGTCAAGGACGATGTCCTC
GACACGATCGAGGAGATGATCGCCCGCATCGACGAGAAGCTCACCGCCCAGGTCAACGCGATCCTGCACG
CGCCCGAGTTCCAGAAGATGGAGAGCGCGTGGCGCGGGCTCCACTACCTCGTGTTCAACTCCGAGACGGA
CGCGACGCTCAAGATCCGCGTCATGAACGTCTCGAAGTCGGAACTCTCGCGCAACCTGAAGCTGTTTCCG
GGGGCGCGCTGGGATCAGAGCCCGCTGTTCAAGAAGGTCTACGAGGCGGAGTTCGGGCAGCTCGGCGGCG
AGCCGTTCGGCTGCCTGATCGCCGACTACCATTTCAGCCACGTCCCGACCGACATCCAGTTGCTGCGGGA
CTTGAGCAAGATCGCGGGCTCGGCCCACGCGCCGTTCTTCGCGGGCGCCGATCCGGCGCTCCTCGGCATG
GACAGCTTCACGGAACTCGCCAACCCGCGCGACCTCGGCAAGATCTTCGAGACGCCGGATTACGGGCCGT
GGAAGTCCCTGCGCGACGCGCCGGACGCCCGCTACCTCGGCCTGTGCATGCCCCGCGTGCTGGCCCGGCT
GCCCTACGGGGCCAAGACCGAGCCGGTCGAGGAATTCGCCTTCGAAGAGGAGACGGACGGGCACGCGGGC
GAGGCCTACGCCTGGATGAACGCAGCCTACGCCATGGCGGTGAACATCAACCGCTCCTACAAGGAGAACG
GCTGGACCGTGCGCATCCGCGGCGTGCAGTCGGGCGGCGAGGTCGTCAACCTCCCCAACCACACCTTCCC
GACCGACGACGGCGGTGTCGACCTCAAGTGCCCGACCGAGATCGCGATCTCGGACCGCCGCGAGGCCGAA
CTCGCCAAGGCGGGGCTCATCCCGCTCATCCACCGCAAGAACACCGACAAGGCGGCCTTCATCGGCGCGC
AGTCGGTCTACCGGCCCAAGACCTATTTCGGCGAGAAGGGCGTCGAGGCGACCGCCTCCGACAACCTCTC
GGCGCGCCTTCCCTACATCTTCGCGGTCTCGCGCTTCGCCCATTACCTGAAGTGCATGGTCCGCGACAAG
ATCGGCTCGACGAAGGAGAAGGACCAGCTCACGAAGTGGCTGCAGGAGTGGATCAACCAGTACGTCGACG
GTGATCCGACCAACTCAAGCGAGCAGACCAAGGCGCGCAAGCCCTTGGCCGATGCCCGGGTGGACATCTT
CGAGGACGAGGAGAACCCGGGCTACTACTCGGCGAAGTTCTACCTGCGGCCGCATTACCAGCTCGAAGGC
ATGGATATCGGCATGAGCCTCGTCTCGCGCCTGCCCGCGCCGAAGGAGTGA