SecReT6
Protein ID: 220922983
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3041
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3134036..3134572 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB8IIB3
KEGG IDmno:Mnod_3041
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-54, Aligned region: 9..161
Protein Sequence: 178 a.a.     [Download]
>gi|220922983|ref|YP_002498285.1| type VI secretion protein [Methylobacterium nodulans ORS 2060]
MSDTGGKFIKRNRPPRVHITYQDPYDAEKNIELPFVMGVMADLSGNDAGVEKPDVAERKFVEFDMDNFDQ
RMAAIEPGIAFRVENRLGEGDGMLSLNLRFRKMSDFGPAAIARQVPALATLLEAREQLANLMRYMDGKAA
ASDQLKALLSDPRLMQALRERTAGPEAPAEDDPPASDA
 
Nucleotide Sequence: 537 bp     [Download]
>gi|220920054|ref|NC_011894.1|:c3134572-3134036 Methylobacterium nodulans ORS 2060 chromosome, complete genome
ATGTCCGATACCGGTGGCAAGTTCATCAAGCGAAACCGTCCGCCGCGGGTGCACATCACCTACCAGGACC
CGTACGACGCAGAAAAGAACATCGAGCTGCCGTTCGTAATGGGCGTGATGGCGGACCTCTCCGGCAACGA
TGCCGGGGTGGAGAAGCCGGACGTCGCCGAGCGCAAGTTCGTCGAGTTCGATATGGACAATTTCGACCAG
CGCATGGCGGCGATCGAGCCCGGCATCGCGTTCCGGGTCGAGAACCGGCTCGGCGAGGGCGACGGGATGC
TCTCGCTCAACTTGCGCTTCCGCAAGATGAGCGATTTCGGCCCCGCCGCCATTGCCCGGCAGGTGCCGGC
GCTCGCCACCCTGCTGGAGGCGCGCGAGCAGCTCGCCAACCTCATGCGCTATATGGACGGCAAGGCGGCC
GCGAGCGACCAGCTCAAAGCCCTGCTGAGCGATCCGCGTCTGATGCAGGCCCTGCGCGAGCGCACGGCCG
GTCCGGAGGCGCCGGCCGAGGACGATCCGCCGGCCTCCGACGCCTGA