SecReT6
Protein ID: 220922985
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3043
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3136157..3137992 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB8IIB5
KEGG IDmno:Mnod_3043
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-80, Aligned region: 31..331
Phage_GPD [PF05954], Evalue: 3.40E-80, Aligned region: 501..558
Phage_base_V [PF04717], Evalue: 1.20E-20, Aligned region: 341..354
Phage_base_V [PF04717], Evalue: 1.20E-20, Aligned region: 375..468
Protein Sequence: 611 a.a.     [Download]
>gi|220922985|ref|YP_002498287.1| ImpA family type VI secretion-associated protein [Methylobacterium nodulans ORS 2060]
MPDEPKQTQRIARLTTPLGADRLVLARFEAEEGLSTLFEFRVDALSTQANLDFTRALGRTCTVSVASYGG
ATRHFNGVLTEARWAGIEQSAYHAYRLTLRPWLWLLGRKADCRIFKDKTPLDIIEDVFQRGGFPDFEVRA
SRGDYPKLDYCVQYRESDLAFVSRLMELYGIYTFHEHGEDRHVLVLADARSCHKPVAAAGGRIPFVALAG
SDQPEAEHIHSWEAERRFRTGRMALNDFDPMKPAADLKADAQASEGYARALLEAYDYPGRYTEQERGRRL
ARVRLQAEQALDHRKHVAGDAVSLAPGGLATVQGHPTDDGEYLVVSARHVFAGEAYRTGAEPVAAGAAYR
GQYEFLRSDIPFRAPPVTPRALVHGPQTATVVARKGKEGEEIDVDEEGRVFVQFHWNRERDVISRPVRVA
QMWAGKSWGWQVIPRVGQEVVVEFLEGDPDRPLVVGAVYNKNNRFPYALLDDKTVSGVKSDASKGHNGHN
EFALDDRKGGELVRLRAERDHETLVRRAETRTIGEAFAPAAGAPSRTTTLRNGDDRLSIENGNWSVEAAG
TVSIKAGTRLVLQVGASRIVMEPARIRIESGDIAIDGAAHLALTSAQLSIG
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|220920054|ref|NC_011894.1|:3136157-3137992 Methylobacterium nodulans ORS 2060 chromosome, complete genome
GTGCCCGACGAGCCGAAACAGACCCAGCGCATCGCCCGGCTGACCACGCCGCTCGGGGCGGACCGGCTCG
TGCTCGCCCGCTTCGAGGCCGAGGAGGGCCTGAGCACCCTGTTCGAGTTCCGCGTCGACGCGCTGAGCAC
GCAGGCGAACCTCGACTTCACCCGCGCGCTCGGCCGCACCTGCACGGTGTCGGTCGCGAGCTACGGAGGC
GCGACGCGCCACTTCAACGGCGTGCTCACCGAGGCGCGCTGGGCCGGGATCGAGCAGTCGGCCTACCACG
CCTACCGGCTCACCCTGCGTCCCTGGCTCTGGCTCCTCGGGCGCAAGGCCGATTGCCGGATCTTCAAGGA
CAAGACGCCCCTCGACATCATCGAGGACGTGTTCCAGCGCGGCGGCTTCCCGGATTTCGAGGTGCGGGCG
AGCCGGGGCGACTACCCGAAGCTCGACTACTGCGTGCAGTACCGCGAGAGCGACCTCGCCTTCGTGTCGC
GGCTGATGGAGCTCTACGGGATCTACACCTTCCACGAGCACGGCGAGGACCGCCACGTCCTCGTCCTCGC
CGATGCCCGCTCCTGCCACAAGCCGGTCGCCGCCGCGGGCGGGCGGATCCCCTTCGTGGCGCTTGCCGGC
AGCGACCAGCCCGAGGCGGAGCACATCCACTCCTGGGAGGCCGAGCGGCGCTTCCGCACCGGCCGGATGG
CGCTCAACGACTTCGACCCGATGAAGCCCGCCGCCGACCTGAAGGCGGACGCGCAAGCCTCCGAGGGCTA
CGCGCGCGCCTTGCTCGAAGCCTACGACTATCCCGGCCGCTACACCGAGCAGGAGCGCGGCCGGCGCCTC
GCGCGGGTGCGGCTCCAGGCCGAGCAGGCGCTCGATCACCGCAAGCACGTCGCGGGCGACGCCGTGAGCC
TCGCGCCGGGCGGCCTCGCCACGGTGCAGGGCCACCCGACCGACGACGGCGAGTACCTCGTGGTGAGCGC
CCGCCACGTCTTCGCGGGCGAGGCCTACCGCACCGGGGCCGAACCGGTCGCGGCCGGCGCCGCCTATCGC
GGGCAGTACGAATTCCTGCGCAGCGACATCCCGTTCCGGGCGCCCCCCGTCACCCCGCGCGCCCTCGTGC
ACGGCCCGCAGACCGCGACCGTCGTCGCCCGCAAGGGCAAGGAGGGCGAGGAGATCGACGTGGACGAGGA
GGGGCGCGTCTTCGTGCAGTTCCACTGGAACCGCGAGCGCGACGTGATCTCCCGGCCCGTCCGGGTCGCC
CAGATGTGGGCGGGCAAGTCCTGGGGCTGGCAGGTCATCCCACGCGTCGGCCAGGAGGTGGTGGTCGAGT
TCCTCGAAGGCGATCCCGACCGGCCGCTCGTCGTCGGCGCCGTCTACAACAAGAACAACCGATTCCCCTA
CGCGCTGCTCGACGACAAGACCGTCTCGGGCGTCAAGTCGGACGCGAGCAAGGGTCACAACGGCCACAAC
GAGTTCGCACTCGACGACCGCAAGGGCGGCGAGCTGGTGCGGCTGCGGGCCGAGCGCGACCACGAGACCT
TGGTGCGGCGGGCCGAGACGCGCACCATCGGCGAGGCCTTCGCGCCGGCCGCGGGCGCGCCCTCGCGCAC
CACGACGCTCCGGAACGGGGACGACCGGCTCAGCATCGAGAACGGCAACTGGAGCGTCGAGGCCGCCGGC
ACGGTCTCGATCAAGGCCGGCACGCGGCTCGTGCTTCAGGTCGGGGCGAGCCGCATCGTCATGGAGCCCG
CCAGGATCCGCATCGAATCCGGCGACATCGCGATCGACGGGGCGGCGCATCTCGCCCTCACGAGCGCGCA
GCTGAGCATCGGGTGA