SecReT6
Protein ID: 220922987
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3045
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3138566..3139867 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDB8IIB7
KEGG IDmno:Mnod_3045
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.80E-16, Aligned region: 30..96
Protein Sequence: 433 a.a.     [Download]
>gi|220922987|ref|YP_002498289.1| FHA domain-containing protein [Methylobacterium nodulans ORS 2060]
MILDLTIENETCLPDGGPLSVRVTGRRGIDIGRDAYLDWSLPDPSRTISGKHCEVRFRDGGYWLHDVSSN
GTYVNGAETRMAGPHRLRDGDRFEIGRYIIAVRVEGEAGESQAPAPAARAPEPVAPDAYWLPAGEAAAPI
PAAELRPARASRPVHAGFDEWIVDVLPPLPAAPEDWAGRPAPARTVAPLGPVPTPRRAVPAEFWERPQEA
APVLPETRLAPSEPAPEPAAPPPRPAATDVAARFAAGLGLPPEVFAERDPGDVAQEAGALLRLTAEHLKD
LLAARAETKRVARATQQTTIRARNNNPLKFSPGVEDALRLMFATRPAAGPDPSGYLDARRALDDGFCDLK
GHQMKTYAAMQGALRLLLQDLAPDAVEESVAGGGLGGLLGGRRGRLWDHYVLRWQAMTAPYEGGVEDAFM
TFFAECYDRGGAA
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|220920054|ref|NC_011894.1|:3138566-3139867 Methylobacterium nodulans ORS 2060 chromosome, complete genome
ATGATCCTGGACCTGACGATCGAGAACGAGACCTGCCTGCCCGACGGCGGCCCCCTGTCCGTCAGGGTGA
CGGGCCGGCGCGGCATCGACATCGGGCGCGACGCCTATCTCGACTGGAGCCTGCCCGACCCGTCGCGCAC
GATCTCGGGCAAGCACTGCGAGGTGCGCTTCCGCGACGGCGGCTACTGGCTGCACGACGTCTCCAGCAAC
GGCACCTACGTCAACGGCGCCGAGACCCGCATGGCCGGGCCGCACCGCCTGCGCGACGGGGACCGGTTCG
AGATCGGCCGCTACATCATCGCGGTGCGGGTCGAGGGCGAGGCGGGCGAGTCGCAGGCTCCGGCCCCGGC
GGCGCGCGCGCCCGAGCCCGTCGCCCCCGACGCCTACTGGCTGCCGGCCGGCGAGGCGGCGGCCCCGATC
CCGGCGGCCGAGCTGCGCCCCGCCCGCGCCTCGCGGCCCGTCCATGCCGGGTTCGACGAGTGGATCGTCG
ACGTGCTGCCCCCGCTGCCGGCCGCCCCCGAGGACTGGGCCGGGCGGCCCGCGCCCGCCCGGACGGTCGC
GCCCTTAGGCCCGGTCCCGACGCCCCGGCGCGCGGTGCCGGCGGAGTTCTGGGAGCGACCGCAGGAGGCC
GCCCCGGTCCTCCCCGAGACGCGGCTCGCCCCGAGCGAGCCTGCCCCGGAGCCCGCCGCCCCGCCCCCGC
GGCCCGCCGCGACCGACGTCGCGGCGCGTTTCGCAGCGGGCCTCGGCCTCCCGCCGGAGGTCTTCGCGGA
ACGCGATCCGGGGGACGTGGCGCAAGAGGCGGGCGCGCTGCTGCGGCTGACGGCCGAGCACCTCAAGGAC
CTGCTCGCCGCCCGCGCCGAAACGAAGCGGGTCGCGCGCGCCACGCAGCAGACGACGATCCGGGCGCGCA
ACAACAACCCGCTCAAGTTCTCGCCCGGCGTCGAGGACGCCCTGCGGCTGATGTTCGCCACGCGCCCCGC
GGCGGGCCCCGACCCGAGCGGCTACCTCGACGCCCGGCGCGCCCTCGACGACGGCTTCTGCGACCTGAAG
GGCCATCAAATGAAGACCTACGCGGCCATGCAGGGGGCATTGCGCCTGCTGCTGCAGGATCTCGCCCCCG
ACGCCGTTGAGGAGAGCGTCGCGGGCGGCGGCCTCGGCGGTCTCCTCGGGGGACGCCGCGGCCGGCTGTG
GGACCATTACGTCCTGCGTTGGCAGGCGATGACCGCGCCCTACGAGGGCGGCGTCGAGGACGCGTTCATG
ACCTTCTTCGCCGAGTGCTACGACCGCGGCGGCGCGGCCTGA