SecReT6
Protein ID: 220922988
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3046
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3139985..3141322 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB8IIB8
KEGG IDmno:Mnod_3046
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-127, Aligned region: 19..440
Protein Sequence: 445 a.a.     [Download]
>gi|220922988|ref|YP_002498290.1| type VI secretion protein [Methylobacterium nodulans ORS 2060]
MSWTSKVAWSEGLFLRPQHLQQADRYVEHLVEARVRPVTPYPWGFSVLEIDHDLAQQGRFGLRRAAGILP
DGTPFDVPGHAPLPAPVEVPEGAGQHLLWLTLPVAAANTRELDAEEADTASRYVHATELLIDSTAPLRVE
EEIEIAHPRLALDLRRTAKPGYVVLPVARVLEVRDHTVVLDERFVPPVLSCAAHPVADGWIDRVVGWIET
RLDELARYAADPTAGGGLQSADYFVLQLLNRHLPVLRHFRASRCVHPERLYEEFLRIAGELATFATIERR
ARAYPVYNQNDLEGVFGPLLRDIQDFLSAQIGRRAIRLEIVERAPNAFVSTIRDRNLFRNANLVLEVSAR
RPLTEIQAQFPHLFKIGPNTKMNEIVHAHLPGVGLVHLPTPPPQIRAMADHVYFLLDRQSPLWPEFSVAS
SLGMHFSGDWPDLALELWAVLEGRR
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|220920054|ref|NC_011894.1|:3139985-3141322 Methylobacterium nodulans ORS 2060 chromosome, complete genome
ATGTCCTGGACGAGCAAGGTCGCATGGTCGGAGGGCCTGTTCCTCCGGCCCCAGCACCTGCAGCAGGCGG
ACCGCTACGTCGAGCACCTCGTCGAGGCGCGGGTGCGGCCGGTCACGCCCTACCCCTGGGGCTTCTCGGT
GCTGGAGATCGACCACGATCTCGCGCAGCAGGGCCGCTTCGGCCTGCGCCGCGCGGCCGGCATCCTGCCG
GACGGAACCCCCTTCGACGTGCCGGGCCATGCCCCGCTCCCGGCCCCCGTCGAGGTGCCGGAGGGCGCGG
GCCAGCACCTGCTCTGGCTGACGCTGCCGGTCGCCGCCGCCAATACCCGCGAACTCGACGCGGAGGAGGC
CGACACCGCGAGCCGCTACGTCCACGCCACTGAACTCTTGATCGACTCGACTGCGCCGCTGCGGGTCGAG
GAGGAGATCGAGATCGCCCATCCCCGGCTCGCCCTCGACCTGCGTCGCACGGCCAAGCCCGGCTACGTGG
TGCTGCCGGTCGCCCGCGTGCTGGAGGTCCGCGACCACACCGTGGTGCTCGACGAGCGCTTCGTCCCGCC
GGTGCTGTCCTGCGCGGCGCACCCTGTGGCGGACGGCTGGATCGACCGGGTGGTCGGCTGGATCGAGACC
AGGCTCGACGAACTCGCGCGCTACGCCGCCGACCCGACGGCGGGCGGCGGCCTCCAGAGCGCGGACTACT
TCGTGCTCCAGCTCCTCAACCGCCACCTCCCGGTGCTGCGCCACTTCCGGGCCTCGCGCTGCGTCCATCC
CGAGCGGCTCTACGAGGAGTTCCTGCGCATCGCGGGCGAGCTCGCGACCTTCGCAACCATAGAGCGGCGC
GCCCGCGCCTATCCGGTCTACAACCAGAACGACCTCGAAGGGGTGTTCGGCCCGCTCCTGCGCGACATCC
AGGACTTCCTGTCCGCGCAGATCGGCCGGCGCGCGATCCGGCTCGAGATCGTCGAGCGGGCGCCCAACGC
CTTCGTCTCGACGATCCGCGACCGCAACCTCTTCCGCAACGCCAACCTCGTGCTCGAAGTCTCGGCGCGC
CGGCCGCTCACCGAGATCCAGGCGCAGTTCCCGCACCTGTTCAAGATCGGGCCCAACACGAAGATGAACG
AGATCGTGCATGCCCACCTGCCGGGCGTCGGCCTCGTCCACCTCCCGACGCCCCCGCCGCAGATCCGGGC
GATGGCCGACCACGTCTACTTCCTGCTCGACCGGCAATCGCCGCTCTGGCCGGAATTCAGCGTCGCGAGT
TCGCTCGGCATGCACTTCTCGGGCGACTGGCCCGACCTCGCCCTCGAATTGTGGGCGGTGCTGGAGGGCC
GGCGATGA