SecReT6
Protein ID: 220922989
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3047
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3141319..3142788 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDB8IIB9
KEGG IDmno:Mnod_3047
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-57, Aligned region: 101..305
OmpA [PF00691], Evalue: 3.90E-15, Aligned region: 381..479
Protein Sequence: 489 a.a.     [Download]
>gi|220922989|ref|YP_002498291.1| DotU family type IV / VI secretion system protein [Methylobacterium nodulans ORS 2060]
MNAPFDPFGRSDRTIILPNPAGRRAPQAALQATSPAPEAPVARRVPASLQAPFPAPSFAAPPAMGEDAWA
RPDPLPPAREPAPPGRALVLRRDVVVAPNENPFLRAAGPLLLLIGRLRVQLSRASFANLMEQVAAAIEEF
EREVRGAGASPEQTRTAKYVVCATADDVVQNIPTEDRHVWTQYSMLSRFFGERVGGVRFFEELERAKLDP
AGNYALLELQHACLALGFQGIHRTSAGGAAALQAIQRNLYETLRRARPAPAEISPRWQGQDIPAAAARPA
VPLWTVAAVTAAALLALYLALRLLLARDADTTAETLVTLHPTTELGIQRRAPVPPPPPPPPPPPSGPAAA
LRDALAADASAGRVTVEETNSQVVVRLAAALFAPGDAAVTAEFRPLLQRVAGLIAREPGPIRIVGHTDSA
PVRNGRFASNFDLSVARAKAVAAAIRAAPEKPERLEVEGKGPDAPVAPNDTVEGRARNRRVEILIPRGS
 
Nucleotide Sequence: 1470 bp     [Download]
>gi|220920054|ref|NC_011894.1|:3141319-3142788 Methylobacterium nodulans ORS 2060 chromosome, complete genome
ATGAACGCGCCCTTCGATCCCTTCGGCCGCTCGGACCGCACCATCATCCTGCCGAACCCGGCCGGACGGC
GTGCGCCGCAGGCGGCCCTGCAGGCGACGAGCCCAGCCCCCGAGGCGCCGGTCGCCCGGCGCGTCCCGGC
GAGCCTCCAGGCGCCCTTCCCGGCGCCCAGCTTCGCGGCGCCGCCCGCGATGGGCGAGGACGCCTGGGCG
CGCCCCGATCCGCTGCCGCCCGCCCGTGAGCCCGCGCCGCCGGGGCGCGCCCTGGTGCTCAGGCGCGACG
TGGTGGTGGCGCCGAACGAGAACCCGTTCCTGCGCGCGGCCGGGCCGCTCCTCCTGCTGATCGGGCGCCT
GCGCGTCCAGCTCTCGCGCGCCTCCTTCGCCAACCTGATGGAGCAGGTCGCCGCGGCGATCGAGGAGTTC
GAGCGCGAGGTGCGCGGCGCGGGCGCCTCGCCCGAGCAGACGCGGACCGCCAAGTACGTCGTCTGCGCCA
CGGCCGACGACGTGGTGCAGAACATCCCGACCGAGGACCGGCACGTCTGGACGCAGTACTCGATGCTTAG
CCGCTTCTTCGGCGAGCGCGTCGGCGGCGTGCGCTTCTTCGAGGAGCTGGAGCGGGCCAAGCTCGACCCG
GCCGGCAACTACGCGCTGCTGGAACTGCAGCATGCCTGCCTCGCGCTCGGCTTCCAGGGCATCCACCGCA
CCTCCGCGGGCGGGGCCGCCGCGCTCCAGGCGATCCAGCGCAATCTCTACGAGACGCTGCGGCGGGCCCG
CCCCGCCCCGGCCGAGATCTCGCCGCGCTGGCAGGGCCAGGACATCCCGGCGGCCGCAGCCCGGCCGGCG
GTCCCGCTCTGGACGGTGGCGGCGGTCACGGCGGCGGCGCTGCTCGCCCTCTACCTCGCCCTGCGACTCC
TGCTGGCGCGCGACGCCGACACGACCGCCGAGACCCTCGTCACCCTCCACCCGACGACCGAACTCGGCAT
TCAGCGGCGCGCCCCGGTTCCGCCGCCCCCACCTCCGCCTCCGCCGCCTCCGAGCGGCCCGGCCGCGGCC
CTGCGCGACGCGCTCGCCGCCGATGCCTCGGCCGGGCGGGTCACGGTCGAGGAGACGAACTCCCAGGTCG
TCGTGCGGCTCGCCGCCGCGCTCTTCGCACCCGGCGACGCGGCCGTGACGGCGGAGTTCCGCCCGCTGCT
GCAGCGCGTCGCCGGCCTGATCGCCCGCGAGCCGGGGCCGATCCGGATCGTCGGCCACACCGACAGCGCG
CCGGTCCGCAACGGGCGCTTCGCCTCGAACTTCGACCTCTCGGTCGCGCGCGCCAAGGCGGTCGCAGCGG
CGATCCGGGCAGCGCCGGAGAAGCCCGAGCGCCTTGAGGTCGAAGGCAAGGGGCCGGACGCGCCCGTGGC
CCCGAACGACACCGTCGAAGGACGCGCCCGCAACCGGCGCGTCGAGATCCTCATCCCCCGCGGCAGCTGA