SecReT6
Protein ID: 22123958
SecReT6 ID29
T6SS typei1
Gene symbol-
Locus tagy0037
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]50781..51281 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ8D1T9
KEGG IDypm:YP_3068, ypk:y0037
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.70E-57, Aligned region: 8..161
Protein Sequence: 166 a.a.     [Download]
>gi|22123958|ref|NP_667381.1| hypothetical protein y0037 [Yersinia pestis KIM10+]
MMSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGVREETSIEERQVVSVNKNNFNSVMN
EANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFSPDNVAKKVPELKKILELREALVALKGPLGNIPAFR
SRLQDLLGNEDMREQLLKELDILNQK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|22123922|ref|NC_004088.1|:50781-51281 Yersinia pestis KIM 10 chromosome, complete genome
GTGATGAGTAAAAATAAGCAAAGCAGTGTTGCCCCAAAAGAAAGGATTAACATCAAGTATGTGCCGAATA
CTGGCGACCAGGTTGCAGAAATTGAATTACCGCTGAATCTGCTGGTTGTGGGTGATCTTAAAGGCGTGCG
TGAAGAGACTTCAATTGAAGAGCGTCAGGTTGTTTCGGTCAATAAGAATAACTTCAACTCAGTCATGAAC
GAAGCAAATATCAGTCTGAGTTTCAATGTGCCTAATCGCCTTGAAGGTGATGGGGAAGAAGACATGCCGG
TCGCCTTGTCGATCAAGGGTCTTGATGATTTCTCGCCTGACAATGTGGCGAAAAAAGTTCCAGAGCTCAA
AAAAATTCTGGAACTACGGGAAGCGTTAGTGGCATTGAAAGGGCCATTGGGGAATATCCCAGCTTTCCGC
TCTCGTCTACAGGATTTGCTTGGCAATGAAGATATGCGCGAGCAGTTGCTGAAAGAATTGGACATTCTTA
ATCAAAAATAA