SecReT6
Protein ID: 22123959
SecReT6 ID29
T6SS typei1
Gene symbol-
Locus tagy0038
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]51349..52830 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ7CLD3
KEGG IDype:YPO3706, ypk:y0038
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-185, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|22123959|ref|NP_667382.1| hypothetical protein y0038 [Yersinia pestis KIM10+]
MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVAAFISSILDTGTNEEPINKLLVDRMI
IELDKKLSAQMDEILHANEFREIESSWRSLKLLVDRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGF
YKHVYSSGYGQFGGEPTAAIIGNYAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAI
KDLKSVFEGPAHTKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAF
LLASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFELAEEGFITLTM
RKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFVINRLAHYIKVLQREQIGSWKERQDL
ERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDVEGDPGWYQVAMQVRPHFKYMGASFELSLVGRL
DKE
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|22123922|ref|NC_004088.1|:51349-52830 Yersinia pestis KIM 10 chromosome, complete genome
ATGCCTTTACATGAAGAAAATACCGTTTTAGCGGCAGAACCTGCCAGTGCAACATTCTTGCTCGACGAAA
TCATGTCACAAACCCGTATGGCACCGGGAAACGATGGTTACGATATCGCTAAACAGGGTGTGGCCGCTTT
TATTAGCAGTATTCTGGATACCGGAACCAACGAAGAGCCGATTAACAAGCTGTTAGTTGACCGCATGATC
ATCGAACTCGACAAAAAGTTGAGTGCTCAGATGGACGAGATCCTACATGCTAACGAATTCCGTGAAATAG
AATCTTCATGGCGCTCATTGAAGCTGTTGGTGGATCGGACCGATTTCCGTGAAAACATCAAAATCAATAT
CATGCATGCAACGAAAGAAGAGTTGCTGGAAGATTTTGAGTTCTCGCCAGAAATTATTCAGTCAGGCTTC
TACAAACACGTTTATTCCTCAGGGTACGGCCAATTCGGTGGTGAACCCACTGCCGCGATCATTGGTAACT
ACGCGTTCAACAATAGCTCACCTGACATGAAGCTCTTGCAATACGTAAGTGCTGTTGGCGCGATGGCACA
TGCCCCCTTCTTATCCAGTGTGGCCCCTGATTTCTTTGGCATCAGCAGCTTCACTGAGTTACCCGCGATT
AAAGATCTGAAATCTGTATTTGAAGGGCCGGCTCACACCAAATGGCGTGCTCTGCGTGAGTCTGAAGATT
CACGTTATCTTGGTTTGACCACTCCTCGTTTCCTGTTGCGCTTACCTTACTCGACCGTTGAAAACCCCAT
TAAAAACTTCAACTACTACGAGGATGTCAGCCGGAATCACGAGCATTTCTTGTGGGGCAACACCGCATTC
CTGCTAGCGTCCTGCCTGACCGACAGCTTCGCCAAGTACCGTTGGTGCCCGAATATTATTGGGCCGCAAA
GTGGCGGCACGGTTCACGATCTCCCGGTTCATCTCTATGAAGCGATGGGGCAGATTCAGGCCAAAATCCC
AACCGAAGTTCTGATCACTGACCGTCGTGAGTTTGAACTGGCGGAAGAGGGCTTTATCACCCTGACCATG
CGTAAAGGCAGTGATAACGCCGCATTCTTCTCGGCGAATTCGGTGCAAAAACCAAAAGTCTTCCCGAATA
CCCGCGAAGGGAAAATGGCAGAAACCAACTACAAGTTGGGCACGCAACTGCCGTACATGTTTGTCATCAA
CCGCCTTGCGCACTACATCAAAGTGCTCCAGCGCGAGCAGATTGGTTCATGGAAAGAACGACAGGATCTG
GAGCGCGAGCTCAATATCTGGCTCAAGCAGTACATTGCCGATCAAGAAAACCCACCAACGGATGTTCGTA
GCCGTCGTCCTCTGCGTTCAGCGCAAATCCAGGTACTGGATGTTGAAGGTGATCCGGGCTGGTACCAGGT
TGCGATGCAGGTTCGCCCGCATTTCAAATACATGGGGGCGAGCTTCGAGCTGTCACTGGTTGGCCGTTTG
GATAAGGAATAA