SecReT6
Protein ID: 22123960
SecReT6 ID29
T6SS typei1
Gene symbol-
Locus tagy0039
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]52837..53277 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ7CLD2
KEGG IDype:YPO3705, ypm:YP_3066, ypk:y0039
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-19, Aligned region: 32..122
Protein Sequence: 146 a.a.     [Download]
>gi|22123960|ref|NP_667383.1| hypothetical protein y0039 [Yersinia pestis KIM10+]
MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNEVLNSRPGACQSAVDLGVIDLNDATA
TSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLNHGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRY
CFNQET
 
Nucleotide Sequence: 441 bp     [Download]
>gi|22123922|ref|NC_004088.1|:52837-53277 Yersinia pestis KIM 10 chromosome, complete genome
ATGGCCGCGCTTCTTAATTGGGATCGAGGGAGTTCTGCCAGTTTGTTTGACCGCATACAGGGGAAGGGCG
CTAGCTCTTCCTCCGATGGCCGTCTGCGTGAGCTATTGAATTCAATCCAAAAGCATTTGAACGAGGTCCT
TAACTCTCGTCCAGGTGCTTGCCAAAGTGCGGTCGATCTCGGGGTTATCGACCTCAATGATGCGACCGCC
ACCTCATCTGATTTTCGAAAAAGTATTGAGAAAGCCATTAAGGATTGTATCGAGAACTACGAACCCCGAA
TTTCTGCCGTTACAGTTCAATCCTTGCTGAACCATGGCGACCCACTGCAACTGAGTTTCCATATTAGCGC
TCGTGTTAATTTCGACGATATGGGTGATGTCGTTGAGTTCAACATTCAGTTAGACAATAACCGCCGTTAC
TGCTTTAACCAGGAAACATAA