SecReT6
Protein ID: 22123961
SecReT6 ID29
T6SS typei1
Gene symbol-
Locus tagy0040
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]53277..54503 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ8CLW8
KEGG IDypk:y0040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.70E-123, Aligned region: 3..354
Protein Sequence: 408 a.a.     [Download]
>gi|22123961|ref|NP_667384.1| hypothetical protein y0040 [Yersinia pestis KIM10+]
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKIDDQFPELTHGL
LNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCR
DVWLFPMSIREISANSSNEQGILSIHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAEL
VVNGITIPMPDFDFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFS
LNLYFSQALPPEVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSW
LSEKGVPKGRGRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVIMDIFYNVTL
 
Nucleotide Sequence: 1227 bp     [Download]
>gi|22123922|ref|NC_004088.1|:53277-54503 Yersinia pestis KIM 10 chromosome, complete genome
ATGTCGTTCGAAAAGTATTTCAGGGACGAGCTGGACTACCTCCGGCAATTAGGACGCGATGCCGCAATAG
AACGGCCTCATCTCGCTGCATTTTTATCTGAGCAAGGTTCTGATCCGGATGTTGAACGTTTGCTGGAAGG
CTTTGCTTTTCTAACGGGCAACCTGCGTGAAAAAATCGATGATCAATTCCCTGAATTGACTCATGGTTTA
CTGAATATGTTGTGGCCGAACTACTTACGGCCAATACCGAGCATGACCATCATCGAGTACACACCGGATG
AAAGTGTGGTCACCGAGGCGACGCTGGTGAAACGGGGTAGCCAAGTGATGAGTATCCCCATCGCACAAAA
TGGTCAGCGCAGCGCGTTTATCAACAGTAATGCTCATGCCGGGCCACAATGTACTTTTACGTTGTGCCGT
GATGTGTGGTTGTTCCCCATGTCCATCCGGGAGATCTCGGCGAACAGCAGTAACGAACAAGGCATTTTGA
GTATTCACTTTGCCGCCAAAGCGGAATTGAACTTACAAGACCTGCAATTGGATAAATTGCGCTTTTATCT
GGGCGAAGACAACTACACCAGCACACAACTCTATTTCTGGATTAACCACTATTTCGAACGCGCTGAACTG
GTTGTCAACGGGATAACCATCCCGATGCCTGATTTTGACTTTAACCCAGTGGGCTTTGAACGCGATGATG
CCCTCTTGCCGTACCCGAAAAACGCCTATATGGGTTACCGGATCCTGCAAGAATATTTTTGCTTCCCCGA
AGGCTTTTTGTTCTTTGATGTCAATGGTGTGGTCGATTTTCCGCCGCACTTGAATGCCAGTGAATTCTCT
CTGAATTTGTATTTCTCTCAGGCATTGCCGCCTGAAGTGAAAGTCCGCTCCACCACACTGCGGATGAATT
GCACACCTGCGGTGAACCTGTTCCAACATGACAGTGAAGCGATTGATCTTGATGGAACCCAGACGGAATA
TCCGCTCTGTGTCAGCTACCATAATCCGGATCACTACGACATCTTTTCAGTTGATCGGGTTGACAGTTGG
CTCAGTGAAAAAGGTGTTCCTAAGGGGCGCGGCCGTGCACTGAACCCCAAAACTTGGACATCTGCTTTAC
TGCTTTTCTACCTGAGTCCGGTATTCTGCCGGACTCATTCCGCCTGTTTTCAGGCTAATGCGCTCTGTAT
TGTAATAATGGATATATTCTACAATGTCACGCTTTAA