SecReT6
Protein ID: 22124177
SecReT6 ID30
T6SS typeN/A
Gene symbol-
Locus tagy0257
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]274727..276829 [-]
ProductVgrG-like protein
NoteTssI
UniProt IDQ8D1M8
KEGG IDypk:y0257
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-70, Aligned region: 102..399
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 382..399
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 439..531
Gp5_C [PF06715], Evalue: 1.40E-05, Aligned region: 573..596
Gp5_C [PF06715], Evalue: 1.40E-05, Aligned region: 598..622
Protein Sequence: 700 a.a.     [Download]
>gi|22124177|ref|NP_667600.1| VgrG-like protein [Yersinia pestis KIM10+]
MSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDAKAKVLDGGVTPLNLAAGGAGAGLPDSAAAALT
RLVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGV
LQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFGFR
HPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLPYNPNVAAQAQEL
SITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLD
ALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAWQLLGVQHSGKQMQALEQASGDQGTVLFNHFSF
IPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQ
GWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHQGEGYNEMRFEDA
KGGEGLFMHAQKDMSTTVKDNQTTTVEKGNQTVTVEKGDRTVTVATGNETTDITQGSLTETIKVRRSTCA
NFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDSIILQFSGSTSITLNAANIDAIAPLINLNKDKG
 
Nucleotide Sequence: 2103 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c276829-274727 Yersinia pestis KIM 10 chromosome, complete genome
GTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGATGCGGTGGGCGGCACTGCCGGTAAGC
GCATTAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGATGCCAAAGCAAAAGTCCTGGACGGCGGCGT
CACGCCGCTGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTACCGGACAGCGCCGCGGCGGCGCTTACC
CGCCTGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGACGGCCAGTTTACCGCCCCAGACCTTTG
CGGTGGTGGATTTCACCCTGAGTGAGATGCTCTCCTCGCCGTTTGTGCTCAATGTCGGGCTGGCGAGTGC
CGATCCGGCGGTGGATTTTGCGGCGGTGCTGGATGAAGACGCCACGCTGTTTATCTGGCGCGAAGGGGTG
CTGCAACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGGCGATACCGGTTTTCATCAGACCCGCT
ACAGCATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGGCGCAATGCCCGCATCTTCCAGCAGGC
CTCGGTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCATCAACGATTTTGCCTTTGGTTTTCGC
CACCCGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTCCGATTTTGATTTTATCCAGCGCCTGA
CGGCAGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGGAAAAATACCGTGGTGTATGCCGATGA
TGTCGGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGAATGTGGCGGCGCAGGCGCAGGAACTG
AGTATCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGATGGTGCAACTGAAGGACTACACCTTTA
AAAACCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAACTGCAAAACCAGCGACCGGACTACGA
GCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGCAGGATTTTACCCGCTACCGGCTGGAT
GCACTGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGATTTTACCCTCCAGCCGGGGCAGTTGT
TCAGCCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGGCAGTTGCTCGGCGTTCAGCACAGCGG
CAAACAGATGCAGGCGCTGGAGCAGGCGTCTGGCGATCAGGGCACGGTGCTGTTCAACCACTTCAGTTTT
ATTCCGCACACCCAGACCTGGCGGCCGACGCCGCTGGCGAAACCGGCGATGGACGGCCCGCAGATCGCCA
TGGTGGTGGGGCCACCGGGGGAAGAGATTTACTGCGACGAATACGGGCGCATCCGCCTGCAATTTTTATG
GGATCGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCCGGGTAACCCAGCCGTGGGCGGGCCAG
GGCTGGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGTGGTGGATTTTCTGCACGGCGATCCGG
ATCAACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATCCCGCCGGGGTCGTTACCGGCCAGTAA
AACCCAGATGGCGTTCCGCTCAAAAACCCACCAAGGGGAAGGCTACAACGAAATGCGCTTCGAGGATGCC
AAAGGCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGAGTACCACGGTAAAAGATAACCAGACGA
CGACGGTGGAGAAAGGTAATCAAACCGTCACCGTAGAAAAAGGTGACAGGACAGTCACGGTCGCGACCGG
AAATGAAACCACAGATATTACCCAAGGGAGCCTGACCGAGACGATCAAAGTGCGTCGCAGTACCTGCGCG
AATTTTATTCAGGTGAAGGCTGAAGGTGATGCGCCTGGTACGCAACTTTATACCGCGACGGAACAGATAA
AGTTCGTGGTGGGCAAGAGCAGCATTACCTTAAATCCGGACTCTATTATTCTGCAATTTTCTGGCTCTAC
CTCTATTACGCTGAATGCCGCCAATATTGACGCCATCGCGCCATTGATTAACTTAAATAAAGACAAGGGA
TAA