SecReT6
Protein ID: 22124190
SecReT6 ID30
T6SS typeN/A
Gene symbol-
Locus tagy0272
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]290946..292352 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ8CLT3
KEGG IDypk:y0272
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-16, Aligned region: 59..118
Protein Sequence: 468 a.a.     [Download]
>gi|22124190|ref|NP_667613.1| hypothetical protein y0272 [Yersinia pestis KIM10+]
MSLVRHMDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQAMALL
SQKSKDFRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFAQQILKRFDSASSSF
SQRADEAQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMAAT
PVSPSLAIDNTSDRAWRQTLLKMADLLSEQQPDAAIGFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADR
TADYLARLANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLF
FTDMTPFLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSA
QLFEKAGLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c292352-290946 Yersinia pestis KIM 10 chromosome, complete genome
ATGTCATTGGTGAGGCATATGGATATCACGTCACAACATCCCTGGCATGTCTTGTTACAAGCCCCTTTGT
CACCTGAGCAGACCGCACAAGCCCTGGCCGATGATGACCCCCAATGGGAATATATCGACGGCCAGATGGT
GAAACTGGGGTCATTGGCCCACGCCACGCTGAATATTGATGATATTCAGCAACAAGCCATGGCGCTGTTA
TCACAGAAAAGTAAAGACTTCCGGCTCGTGGTGCATCTACTGCGCACCCTACAACACGGGGGCCAGCCAG
ATGAATTAATGCTGGCGATGTCGTTGCTGACCGAATACGTCCAGCTATTTTGGACTACGGCCTGGCCGCA
AAATCCTTTACACAAACGGCGCTTTGCTCAACAAATCCTAAAACGCTTTGACAGCGCCAGCAGCAGTTTT
AGCCAACGAGCGGACGAGGCTCAACGTGAGAATGTGCAAGGATTATTGGCACATTTAGCACAGGTTTGGC
ATAGCCGTGAGCCGGGTCTGGCTAAAGAGGTGGATGCATTACGCAGCCGCTATGCGCGGCCACCGGAGCG
GGTTATCGAGGCAGTGGCTTCTGATGAACCGCTCTCATCCAACACCTTGGCGGCGGCAATGGCCGCCACC
CCCGTTAGCCCAAGCCTCGCCATAGATAACACGAGCGACAGAGCCTGGCGGCAGACCTTGCTGAAAATGG
CGGATCTACTCAGCGAACAGCAACCCGATGCCGCTATCGGTTTCCGGCTACGCCGCCATGCCGTATGGGG
CGCGTTAACCGCACCACCTATGGCGCAGAGCGATGGCCGCACCCCGTTAGCCGCGGTATCTGCGGATCGA
ACCGCCGATTACTTAGCACGTCTGGCTAATGCCGATTTGCCTTTGTGGCACCAAGTGGAGCAGAGCCTCA
CCCTCGCGCCTTATTGGCTGGATGGACATGTGCTTTCGGCACAAATCGCCCTGCAACTGGGTTATGACGC
GGTGGCACAGGCTATCCGTGATGAACTCAGCGTTTTTTTAGCCCGTATTCCCGCATTAAAAACCCTCTTT
TTTACGGATATGACGCCATTCCTCTCCTCTGAATCTGCCGCCTGGTTACAGCAGGATGCGAATCATCAGG
GAAGAAGTCGCACTATTGAACAGGATGAAATTTGGCAATGCTATCAACAGCAAGGATTGGAAGCCGCACT
ACAGATGATAAACCGGCAACCACAGCAATCCGAACCTCGGGACCGTTTTTACCATCAATTGCTCAGTGCA
CAGTTGTTCGAAAAAGCAGGGTTAACCGCATTGGCGCAGCAGCACTACCACAGCTTATTACTGGTAGGGC
AGCAATTACAGCTAAGCGAATGGGAACCTGCGTTGATCGCTCTACTGACAGAAAAACAGCGACAACTCAA
ACCATGA