SecReT6
Protein ID: 22124196
SecReT6 ID30
T6SS typeN/A
Gene symbol-
Locus tagy0278
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]298547..299092 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ7CL27
KEGG IDypk:y0278, ypm:YP_3954, ype:YPO3596
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-36, Aligned region: 17..174
Protein Sequence: 181 a.a.     [Download]
>gi|22124196|ref|NP_667619.1| hypothetical protein y0278 [Yersinia pestis KIM10+]
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQATDQPSTVRLTLLSDPDTNPNEKGE
AVPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIA
HYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEEE
 
Nucleotide Sequence: 546 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c299092-298547 Yersinia pestis KIM 10 chromosome, complete genome
ATGAACAACGCCAGAGGCTATCTCCTGACGTGGGCATTATGTGTGGTGTTCCTGTTGTCTGGGTGCAGCG
GTGCATGGGAAGCCACTAAAAAGGTCGGCAAGGTGGTTATGGACCCTGATATTCCGGTGGGGCAGGCTAC
CGATCAACCCTCAACGGTCAGGCTAACATTGCTGTCCGATCCCGATACCAACCCTAATGAAAAAGGGGAA
GCGGTACCGACTGAGATAGTGGTGGTGTACCTAAGTGAAAACTCCAAGCTGCTGGCCGCGGATTATGATC
AGCTAAGCAGTGACGCGTTGGAGAAAACGCTGGGTAAGAATTACATCGATCATCAGGAATACACCTTACT
GCCCGATCAATTCAAGGCGCTGGACCCTATCAAGCTGGAAGAGAAAAACAGCTATCTGGGGGTGATTGCT
CACTATGCCGATGCCAACCGCAGTGAATGGAAGAAGATCATCAAAATAAAAGGGATCGGCCATAACTACC
AGGTTTTGGTCCATGTCAGATCAAACGATGTCGATCTAAGGAAAGAGGAAGAATAA