SecReT6
Protein ID: 22124198
SecReT6 ID30
T6SS typeN/A
Gene symbol-
Locus tagy0280
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]300534..301631 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ8CLT0
KEGG IDypm:YP_3956, ypk:y0280
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.50E-93, Aligned region: 41..351
Protein Sequence: 365 a.a.     [Download]
>gi|22124198|ref|NP_667621.1| hypothetical protein y0280 [Yersinia pestis KIM10+]
MLRMAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPA
NEAIRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMN
VFNHRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRA
PEVICSLVSHCFNLPDITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGK
FLLCINKLTREQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSIL
GDPEQKPSVTIGVME
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c301631-300534 Yersinia pestis KIM 10 chromosome, complete genome
ATGTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTAAGTGTGGTTGAGGATGTAAGTGGGG
TTGAGAATGTAAATGGGGTTGAGGCAAGACCCGAAGGGCAGGCATTGGATGTTTCACGTTATAACTTTTT
TCAATTGGTCGAATTGCTCAACCAATTGGCGGTAGCGTGGCAAGGTGCGGCCCCTGTGGCGACCCCAGCC
AATGAAGCCATCCGTTTTAAATCGACCGCCAGTTTAGCATTCCCGACCAGAGATGTGATCGCACTGGACA
CCTCCGCCCGAGGTCAATTTGAGTTAGAGGTCTCTTTCCTTGGATTGCATGGCAGCCAATCGCCGCTACC
AGGATATTACCTCGATTCGTTAGCGTGGGAGGATGCGCAGAATGAGAACCGGCTAACGGATTTCATGAAC
GTATTCAACCACCGCCTGTTAACGCTACTGCATCAGATTTGGCGTAAATACCGTTACTACATCTGCTTTG
ACAATGGCGGTGATGATGCATTTTCACAACGCATGTTCTCGCTGGTGGGGTTAGGTAGCGAGGTCGTCCG
CAATAAATTGCAGATCAATCACAGCAAAATGCTGGCTTATGCAGGGCTGCTGGCCAGCCCCGGCAGAGCA
CCTGAAGTGATTTGCAGCCTTGTCTCACATTGCTTCAATTTGCCAGATATCACCTTACACAGTTGGCAGC
TACGCAAAGTGGATATTGCCCCCTCACAGCAGAATCGCTTGGGGACGAGGGTGAAAGTCCGTGGCAAGAA
ATATGATGAAAAATCAGTGCTTGGCGTTAATTTCTCCATCGGTTCACGGGTTGCGGATCGTAGCGGGAAA
TTCTTGTTGTGCATCAATAAGCTGACGCGAGAACAGTTCTTATCCTTTTTACCCAACGGGGCTAATTACG
CCTCGTTAGTGATGTTTGTCGCCTTCATTATGCGCGATCAATTCGCGTGGGATTTACGCCTTGGGTTGGC
CGAGCAACAGGTGGGCGGGATGGTGTTGGGAACCGAGCAAAATAGCCTATTGGGCTGGACCAGTATCCTC
GGCGATCCCGAACAGAAACCCAGCGTAACGATTGGTGTAATGGAATAA