SecReT6
Protein ID: 22124199
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy0281
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]301586..302458 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ8CLS9
KEGG IDypk:y0281
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.80E-74, Aligned region: 45..290
Protein Sequence: 290 a.a.     [Download]
>gi|22124199|ref|NP_667622.1| hypothetical protein y0281 [Yersinia pestis KIM10+]
MRFPAEWPFLKGNVEPPLGGLKKGVSLNRTSRSWIKRSKIWGSVHRGHGREYTSFESFHHQIEHSQEKTA
LYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAEENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATF
RNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRI
ETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEW
PVQTGQHALM
 
Nucleotide Sequence: 873 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c302458-301586 Yersinia pestis KIM 10 chromosome, complete genome
GTGCGGTTTCCCGCAGAGTGGCCTTTCCTGAAAGGTAATGTTGAACCGCCGCTAGGCGGGTTGAAAAAGG
GTGTTTCATTGAACCGAACCTCCAGATCATGGATAAAAAGATCCAAGATCTGGGGTTCAGTGCACCGGGG
TCATGGCCGGGAGTACACCTCGTTTGAGAGCTTCCACCATCAGATCGAACACTCGCAAGAAAAGACCGCA
CTTTATTACCGCCTACGTGTGAAAAATTCATTATTCCGTAAGGGATTCGAACACTACATTTCCTTTGTTC
GCAGTGATGAATCGAAGCTGGTGCTTGCTGAAGAGAATGTCTCGGTCAGCCTGACGTGCACCAACCGTGA
GTTGCCGCTGTCGTTGCGCGTTGGTGATATCAATCAACTCAGCACAGACAGCCCTTCATTCGCGACGTTC
CGCAATATTACCCGTCCTTCCGTGCCGTTGTATCCGGTGCTGGATGGGGGCCTGCATTGGTCATTGCTCT
CCAATATGTCGTTGAACTACATGTCCTTACTGGATAAGGACGCGTTGAAGCAAATTCTGCATACCTATGA
TTTCCCAAGCCTGCATAACCGGCAATCAGCCAGGGCATCGCAAAAGAAACTGGACGCTATCCAACGTATT
GAAACACAACCGATTGACCGGTTGTTTCGTGGCTTACCTGTCAGAGGGCTACAAACCACGCTATGGCTGG
AGCAAGGCGCTTTTAGCTCTGAAGGCGAGCTTTATCTCTTCAGCACGGTATTAGCTCGCTTCTTCTCACT
GTATGCCAGCGTCAATGCGTTTCATCTTTTAAAAGTCATCAATCTTGATAATCAGGAATGTTACGAATGG
CCGGTACAGACAGGTCAACATGCACTGATGTAA