SecReT6
Protein ID: 22125427
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy1530
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]1693125..1694807 [-]
Producthypothetical protein
NoteTagL
UniProt IDQ7CJD5
KEGG IDypk:y1530, ype:YPO2953, ypm:YP_2580
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 191..217
OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 441..539
Protein Sequence: 560 a.a.     [Download]
>gi|22125427|ref|NP_668850.1| hypothetical protein y1530 [Yersinia pestis KIM10+]
MFKVKLNKTLSLLWLAAVGALLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKHPQVSTPIPQET
AEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSARVLTFFPF
LPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEIT
QALQSLSQRLELQDINHSRFATQRNVMAHNLFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRH
GAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAMKPRVKTPVIKPTPASRGWLWSVCFAAVLLASHM
LNTLWQEKNRHEQFNQQMVPLDNISDFSAQYLARSITQLTDEGKILTTCVNTFDVTRWGLSQCKTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVERNKEKKILIVGHSDNTGSSSMNM
ALSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c1694807-1693125 Yersinia pestis KIM 10 chromosome, complete genome
ATGTTTAAGGTTAAATTGAATAAAACGCTCTCTCTATTATGGCTGGCTGCGGTCGGCGCCCTATTGGTGA
GTGTGAATTTTAAGGGAAATGCGTTATGGAATAACGTTATTTTCATTACTTTCCTGGCGCTGATGGTTCT
TGCCATCTGGAAACATTACGCCCTCAAACCCAAACACCCCCAAGTGTCGACTCCCATTCCGCAGGAGACA
GCGGAACCTGTAGAACAGGAGAGTACGGTTATTTTAATTCTCGGTCCCTATGCTGAGAAATGGTTTAGTA
ACCCAGAATCGCCAGACAGTACACGTTTTTCCAGCCATGCGGTTTGGATATTAATCACGAATCCCGCCGC
GCTGCAAAAACGCCTCACATATATTGCTGAACATCATCCATCCGCTCGGGTATTGACCTTTTTCCCTTTC
TTGCCGGATGTCTATGAGAATGCAGCAGTGATGATGTCAAAACTCACTGTGTGGCAGAACACTTTTTCAA
CGTTATCACTGCGATCCCCCCTCCCCTGCGTATTTGCTATTTACGCGCAGTTGAGTAATGAACGCCTTAG
CCATAATTCTGATAACGCATATTGGACTGGAAATATTAATCTTGCGAACCAGCAGCCTATCGAGATTACG
CAAGCCCTACAGTCACTGAGCCAACGACTTGAGTTACAAGACATCAATCACTCAAGATTTGCAACTCAGC
GTAATGTTATGGCGCATAATTTATTTACTTGGTTGAATGAATCGGGGGTGACAAACCTTCTGCAATCTAT
TTTCTCTCGCACCCCCTTACGGCTAACAGATGTCATTTTGTCGGATAATGGCAAAGGGTTCATCAGGCAT
GGTGCCTGGTCAGCCTGGCTGGAAAAAAAGTTTGGCATCATACCAAGCTTAGCCTCAACCTTGTCACTGC
CACCTTTCCCAGCGGTGATCAATGACCAGAAGCCCGCAATGAAACCACGGGTGAAAACACCGGTGATAAA
ACCTACCCCCGCATCCCGCGGGTGGTTATGGAGTGTATGCTTCGCCGCGGTGCTATTAGCCTCACATATG
CTAAACACCCTGTGGCAAGAAAAAAACCGGCATGAGCAATTTAACCAACAGATGGTGCCGTTGGACAATA
TCAGCGATTTTTCTGCTCAGTACCTGGCACGCAGCATCACCCAGTTAACTGATGAAGGTAAAATATTAAC
CACATGCGTTAATACATTTGATGTCACACGTTGGGGGCTGTCTCAATGCAAGACGTTATTAAGCCAAATC
AACCGCCGGATTGAATCCTATGAAAATATTCCTGTTTTCAGTTTTGCCCAAAAGCTCCCTCTGTTTGACT
CAAACAGTACCAAGCTGAAACTGAACTCACAAACTAATGAAATGATGATGGAGTTGTTATCACTGGTCGA
ACGGAATAAAGAGAAAAAAATCTTAATTGTTGGCCATTCTGATAACACAGGCAGTTCCTCCATGAACATG
GCACTTTCCGAACAGCGTGCGCTGGCCCTTCGCGATTGGTTAATTAAACGCAGTGATATCACTGTCGATA
ATTTTATTACCAAGGGAATGGGGGCTTCAGAACCGGTTGCGACCAATCACACGGAAGCGGGTCGAGAACA
AAACAGACGCGTCGAAGTACTGATATTACCCACACAAGATAGAACAAGAATGACGGAGCCTAAACCTTTA
TGA