SecReT6
Protein ID: 22125431
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy1534
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]1697921..1698991 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ8CLE5
KEGG IDypk:y1534
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 25..84
ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 166..178
Protein Sequence: 356 a.a.     [Download]
>gi|22125431|ref|NP_668854.1| hypothetical protein y1534 [Yersinia pestis KIM10+]
MLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKCLELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAIL
WCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELEDIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREE
GALDEGTLEAVKQEWQNRSDHTILSLQHAYALLQGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAP
IVVPIPEVVELYPVATAMLASTEMPVTAEVQTVAETQMAIPIEAPQQRQAVVTPSPQLQPLQLQSAQLQP
VPIQSQPVPVQQQGIQNRADALARLIEVREWFTAMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISK
LNEGQE
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c1698991-1697921 Yersinia pestis KIM 10 chromosome, complete genome
ATGCTACAGACAAAATTGCAACCTAAGCAGGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCCA
ATAACTGGACAGATATCGAGCGTAAATGCCTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTAT
TATTCTGATGCGCTGCCGGATGCGTCAGGTCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTT
TGGTGCCTCGACACTTGGCCTGATCAGCTACATCCTCAGTTGTTTGATGAAGGGGAATTTGAACCTTTAA
TGCGCGGTAATGCTTTTGCTGAACTGGAAGATATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTT
ACCCAAAGCCGCTGGCGTGCAACTTTCCATCAAAGAGTTTGAAAAAGCACACTCCGTTCCTCGAGAAGAA
GGGGCATTGGACGAAGGGACTCTGGAAGCCGTTAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTC
TCTCACTCCAGCACGCTTATGCCTTGTTGCAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGA
CACACCTGATTTTGTCAGAATGACCTCAGTGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCT
ATCGTGGTGCCGATCCCAGAAGTTGTCGAGCTCTATCCAGTCGCCACAGCGATGCTAGCAAGCACAGAAA
TGCCAGTGACCGCCGAGGTACAGACGGTTGCAGAGACACAAATGGCCATACCCATTGAAGCTCCCCAACA
GCGTCAAGCGGTGGTAACCCCATCCCCACAGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCT
GTACCGATACAGTCACAGCCGGTGCCTGTCCAGCAGCAAGGGATCCAAAACAGGGCTGATGCATTAGCCC
GGCTTATAGAGGTGCGAGAGTGGTTTACCGCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTT
TTCAGAAAAAACTATCGGCAAAAGCTTCGGCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAA
CTCAATGAAGGACAGGAGTAA