SecReT6
Protein ID: 22125432
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy1536
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]1699201..1700262 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ8CLE4
KEGG IDypk:y1536
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.40E-88, Aligned region: 34..333
Protein Sequence: 353 a.a.     [Download]
>gi|22125432|ref|NP_668855.1| hypothetical protein y1536 [Yersinia pestis KIM10+]
MESPPWQTRSPVMLPDESVHQEKHANLDAWYQESQPWNAGFISMMRANAARNPTLPAPGKAPLPEQEAFR
IGQSAHMTFSPREISHAVMRDGKMDLQLFGLGIWGPNGAMPLQMTELAYTRAELHDHTMTDFVDLFHHRA
LSQLYRAWFVSQDTASLDRQSDEKFSFYVGSLAGLDPQELNDTELPVHARLASSAHLIREARNPEGLVGA
LQYYFDVPVRMVEYAEQWIFLEESDQTQLGDGAGAMLLGDGAILGNTVLDRQHKFQLILGPLSLQQYLRF
SLWGQDLPVLREWVRNFVGFEYAWEVQLLLSADEVPMATLDGGHQLGYTSWLARSDTTLDVGGMSFEPEM
HHD
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c1700262-1699201 Yersinia pestis KIM 10 chromosome, complete genome
TTGGAAAGCCCGCCCTGGCAGACGAGGAGTCCTGTAATGTTACCCGATGAATCCGTTCACCAGGAAAAAC
ATGCCAATCTGGACGCCTGGTATCAGGAGTCTCAGCCATGGAACGCCGGTTTTATCAGCATGATGCGGGC
GAATGCCGCCCGCAACCCTACCCTGCCAGCGCCAGGAAAAGCGCCCTTGCCTGAACAGGAAGCCTTCCGC
ATCGGGCAAAGTGCGCACATGACGTTCTCTCCGCGTGAGATATCTCACGCGGTCATGAGAGACGGGAAAA
TGGATCTGCAACTTTTTGGCTTAGGGATTTGGGGGCCAAATGGTGCGATGCCGCTTCAGATGACCGAACT
GGCCTATACCCGTGCCGAGTTGCATGATCATACGATGACGGATTTCGTCGACCTTTTTCATCACCGCGCA
TTATCACAGCTTTATCGGGCGTGGTTTGTCTCTCAGGATACCGCCTCGCTAGATCGGCAGAGTGATGAAA
AATTCTCCTTCTATGTCGGTAGTCTCGCCGGGCTGGATCCTCAAGAACTTAATGATACCGAACTCCCGGT
TCATGCCCGGTTAGCCTCCTCTGCCCATTTGATTCGTGAAGCGCGCAACCCCGAAGGGCTCGTGGGCGCA
TTGCAGTACTACTTTGACGTCCCCGTGCGGATGGTGGAGTACGCCGAGCAGTGGATCTTTCTGGAAGAAA
GCGACCAGACACAATTGGGTGATGGTGCAGGCGCGATGCTCTTGGGCGACGGTGCTATTTTGGGCAATAC
CGTTTTGGATCGGCAGCATAAATTTCAACTGATCCTCGGCCCCCTCAGCCTGCAACAGTACCTGCGCTTT
AGCCTCTGGGGACAAGACTTACCGGTATTGCGAGAGTGGGTACGTAACTTTGTTGGGTTCGAATACGCCT
GGGAAGTCCAGTTGTTGTTAAGCGCCGATGAGGTTCCCATGGCAACACTCGATGGCGGACATCAATTGGG
ATACACCTCTTGGTTAGCCCGCAGTGATACCACCCTTGATGTCGGTGGGATGAGTTTTGAGCCTGAAATG
CATCACGATTAA