SecReT6
Protein ID: 22125441
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy1545
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]1712028..1712573 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ8CLE1
KEGG IDypm:YP_2757, ypk:y1545
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-59, Aligned region: 18..171
Protein Sequence: 181 a.a.     [Download]
>gi|22125441|ref|NP_668864.1| hypothetical protein y1545 [Yersinia pestis KIM10+]
MFEIKAYMVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLL
DIDIDNFDERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQ
TYMDGKAGAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
 
Nucleotide Sequence: 546 bp     [Download]
>gi|22123922|ref|NC_004088.1|:1712028-1712573 Yersinia pestis KIM 10 chromosome, complete genome
TTGTTTGAAATTAAGGCATATATGGTTAGCAAAAGTAATTCTCAAAAGTTTATCGCTCGAAACCGAGCGC
CACGCGTGCAGATTGAATACGATGTGGAAATATACGGTAGTGAAAAGAAGGTTGAATTACCTTTCGTTAT
GGGGGTATTAGCAGATTTATCCGGTAAACCTCTTGAGCCTTTACCTTCAGTCGCTGACAGAAAACTGTTA
GATATCGATATTGATAATTTCGATGAGCGCATGAAAGCAATGAAACCACGTGTTGCATTCGCCGTGCTGA
ATACATTGACTGGGGAAGGCCAGTTAATGGTCGATATTACGTTTGAGAGTATGGATGATTTCTCTCCTGA
CGCTATCGCGAAAAAAGTTGATTCATTGTCTCAATTATTAGATGCCCGAACTCAACTTGCCAACTTGCAG
ACTTATATGGATGGTAAGGCTGGTGCTGAGGAATTAGTTATGAAATTGCTGAAAGACAAATCATTACTGA
CAACGCTTGCATCCGCACCGAAAGCAAAACAATCCGCTGTTGATACTCCACAGTAA