SecReT6
Protein ID: 22125442
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy1546
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]1712576..1714099 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ8D0V3
KEGG IDypm:YP_2758, ypk:y1546
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.10E-194, Aligned region: 75..501
Protein Sequence: 507 a.a.     [Download]
>gi|22125442|ref|NP_668865.1| hypothetical protein y1546 [Yersinia pestis KIM10+]
MIKKRKTMSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVSDDA
YKSIASIIAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRY
KGVAWDQSPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQ
MESWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLSRLPYGINTNPVDAFHFEETTDGA
DHSKYVWSNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRRE
AELAKNGFIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKI
GSFKERDEMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQLEGL
TVSLRMVAKLPSLKDVA
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|22123922|ref|NC_004088.1|:1712576-1714099 Yersinia pestis KIM 10 chromosome, complete genome
TTGATTAAGAAGAGAAAAACGATGTCCACTCAAGACGCAAAAACTAAACAAGCTACAGTCGCCAGTGCGA
CGGAATATAGCGATTTTAATACATTACTGACTAAAGAATTTAAAGCGAAGTCTGAGCAAACGATAGCCGC
AGTAGAAGGTGCCGTTAAAACGTTGGCTGAGCAAGCGCTGGCTAATTCGGTCACGGTGTCAGACGATGCT
TATAAAAGTATTGCTTCCATTATTGCAGAGATTGATCGCAAGCTATCAGATCAGATTAACTTAATTTTGC
ACCACCAAGAATTCCAGTCTCTGGAAAGCGCATGGCGTGGGCTGCACTATTTAGTCAATAACACCGAGAC
TGATGAGAAGTTGAGATTACGTTTCCTCGACATTTCTAAAGATGAATTACGCCGTAACATGAAGCGTTAT
AAAGGTGTTGCTTGGGATCAAAGCCCATTATTCAAAAAAATCTATGAAGAAGAATATGGCCAATTGGGTG
GCGAACCATACGGTTGCCTGGTAGCAGACTATTACTTTGACCATACTGCACCTGACGTTGACTTGTTGGC
TTCAATTGGCAAAGTTGCCGCTTCTGCCCACGTGCCATTTATTACAGGTGCTGCACCGTCTGTGTTGCAA
ATGGAATCTTGGCAAGAACTGTCAAACCCACGTGATTTGACGAAGATCTTCACTCAGAATCTTGAGTATG
CCGCATGGAACTCACTGCGTCAGTCTGAAGACTCTCGCTATATCGGCCTGGCGATGCCACGTTTCTTGTC
GCGTCTGCCTTATGGGATTAACACCAATCCGGTAGATGCCTTCCACTTTGAAGAGACGACTGATGGCGCG
GATCACAGCAAATATGTGTGGTCAAATGCGGCTTATGCGATGGCTGTTAACATCAACCGATCTTTCAAAG
AGTATGGCTGGTGTACGCTGATTCGTGGTGTGGAAAGTGGTGGTGTTGTTGAAGGCCTGCCATGCCATAC
CTTCCCGACGGATGACGGCGGTATTGATATGAAATGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAA
GCGGAACTGGCCAAGAATGGCTTTATTCCACTGGTTCACAGAAAGAATACGGATTACGCGGCATTCATTG
GCGCGCAGTCCCTGCAAAAACCTGCAGAATATTACGATTCGGATGCAACGGCGAACGCCAACCTTTCCGC
TCGTCTGCCATACCTGTTTGCTTGTTCACGTTTTGCACATTATCTGAAGTGCATCGTGCGTGACAAAATC
GGCTCTTTTAAAGAGCGTGATGAGATGCAACGTTGGTTGAATGATTGGGTGATGAACTATGTTGATGGTG
ACCCAGCTAACTCTTCCCTGGAAACTAAAGCGCGCCGTCCTTTAGCCGCCGCTGAAGTGATTGTTGAAGA
AGTTGAAGGTAACCCTGGTTACTATCAGGCTAAATTCTTCTTACGCCCTCATTTCCAGTTAGAAGGTTTG
ACAGTATCCCTGCGTATGGTTGCTAAACTGCCTTCGCTGAAAGACGTAGCATAA