SecReT6
Protein ID: 22125444
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy1548
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]1715124..1715723 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ8CLD9
KEGG IDypk:y1548, ypm:YP_2760
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.00E-36, Aligned region: 42..192
Protein Sequence: 199 a.a.     [Download]
>gi|22125444|ref|NP_668867.1| hypothetical protein y1548 [Yersinia pestis KIM10+]
MWIRLNVFLIRLSMILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADIN
PNDKGVANPLRIALYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAI
GIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 600 bp     [Download]
>gi|22123922|ref|NC_004088.1|:1715124-1715723 Yersinia pestis KIM 10 chromosome, complete genome
TTGTGGATAAGGCTTAACGTTTTTTTAATTAGGCTAAGTATGATTTTAATTAGGCTAAGTATGAATAAAA
GTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTTTGGTACTGGTAACGTTATTGACGATAGCCTG
TAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAGCTTACCGTCGAAATCGCGACAGCAGCGGATATTAAT
CCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCACTTTATACACTCAAGAGCACCGATGAATTTC
AGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGCCATCGCTAAAAGAACAAATGGATAACGTGTT
TGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGAGCTGACACTTGATGCTGGCGTTACTGCTATC
GGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAGTGGAAAGCGGTTATTTATCCGTTGCCCAAAA
AACGCGTGGATCCTTGGTATAAAAAAATGTGGCCAGGGCAAGACCAACAAGATCCGATCATGAAGGTACG
CGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTAA