SecReT6
Protein ID: 22125452
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy1557
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]1727222..1727482 [+]
Producthypothetical protein
NotePAAR
UniProt IDQ8CLD4
KEGG IDypk:y1557, ypm:YP_2440
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 6..78
PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 73..86
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 16..36
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 38..70
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 75..85
Protein Sequence: 86 a.a.     [Download]
>gi|22125452|ref|NP_668875.1| hypothetical protein y1557 [Yersinia pestis KIM10+]
MFSAAKMGDVTSDGGAICTGSCDVFINNIPASKLGSGATSTLVGLTALVTGSGTVFINNCPATRCSDKTG
CGSVIVTGSPNVFIGN
 
Nucleotide Sequence: 261 bp     [Download]
>gi|22123922|ref|NC_004088.1|:1727222-1727482 Yersinia pestis KIM 10 chromosome, complete genome
ATGTTCAGTGCGGCAAAAATGGGCGATGTGACCAGCGATGGTGGTGCGATATGTACCGGTTCATGCGATG
TGTTCATTAACAATATTCCGGCCTCTAAGCTGGGTTCGGGCGCAACGTCTACGTTGGTAGGCCTGACGGC
GCTGGTAACTGGCTCTGGAACGGTATTTATCAATAATTGTCCCGCGACGCGTTGTAGTGATAAGACGGGG
TGTGGCTCGGTTATTGTCACTGGGTCGCCCAATGTATTTATAGGTAACTAA