SecReT6
Protein ID: 22125456
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy1561
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]1729285..1729764 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ7CJC4
KEGG IDype:YPO2728, ypk:y1561, ypm:YP_2437
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-16, Aligned region: 35..138
Protein Sequence: 159 a.a.     [Download]
>gi|22125456|ref|NP_668879.1| hypothetical protein y1561 [Yersinia pestis KIM10+]
MEKKKQFLPALLERLLDDEPKKHIEPHDKFFYDSRTMRKLVQRNISEILNNANIEDRLDPQRHKWVATSV
LNYGISPLVGLYAVPHNWATIERIIREAIIRFEPRIMAESLVVSQQLQARNGIIQFEIRGLIKWNPHPID
LCIEGAYDVETDNAELRAR
 
Nucleotide Sequence: 480 bp     [Download]
>gi|22123922|ref|NC_004088.1|:1729285-1729764 Yersinia pestis KIM 10 chromosome, complete genome
ATGGAAAAGAAAAAACAGTTTTTACCGGCGTTGTTAGAGCGTTTACTCGATGATGAGCCTAAAAAGCATA
TTGAGCCTCACGATAAATTCTTTTATGACTCACGGACGATGCGGAAATTGGTACAACGTAATATTTCAGA
GATATTAAATAATGCCAATATTGAAGACCGGTTGGATCCGCAGCGTCATAAATGGGTAGCGACGTCGGTC
TTAAACTATGGTATTTCACCCCTGGTCGGGCTTTATGCCGTGCCGCATAATTGGGCGACTATTGAACGAA
TTATCAGAGAGGCCATTATCCGTTTTGAACCACGGATAATGGCGGAATCTCTCGTTGTCAGCCAGCAACT
CCAGGCCAGGAATGGCATTATACAGTTTGAGATTAGGGGGTTAATCAAATGGAACCCGCACCCTATCGAT
CTTTGTATTGAAGGTGCCTATGACGTTGAGACGGATAACGCAGAGCTACGCGCCCGTTGA