SecReT6
Protein ID: 22126559
SecReT6 ID32
T6SS typei2
Gene symbol-
Locus tagy2680
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]2959098..2959367 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ8CKX5
KEGG IDypk:y2680
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.50E-05, Aligned region: 11..55
Protein Sequence: 89 a.a.     [Download]
>gi|22126559|ref|NP_669982.1| hypothetical protein y2680 [Yersinia pestis KIM10+]
MSKILQGLPGSAHSLLTTLSATLLKYEPRLKSLQVILLPQTTPGHLEYAIDAELKGLGLVRYGTAFMPEG
RVLMRHLKQQHYLNQRESF
 
Nucleotide Sequence: 270 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c2959367-2959098 Yersinia pestis KIM 10 chromosome, complete genome
ATGAGTAAAATTCTGCAGGGGTTGCCGGGCAGCGCGCATTCGCTGCTGACCACGCTGTCCGCCACCTTGC
TGAAGTACGAGCCGCGTCTGAAAAGTTTGCAGGTGATTCTGTTGCCACAGACCACACCCGGTCATCTGGA
ATACGCCATTGATGCGGAGCTGAAAGGGCTGGGACTGGTGCGCTATGGCACGGCGTTTATGCCGGAGGGC
CGGGTGCTGATGCGCCACCTTAAACAACAACACTACCTCAATCAGCGGGAGTCATTTTGA