SecReT6
Protein ID: 22126560
SecReT6 ID32
T6SS typei2
Gene symbol-
Locus tagy2681
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]2959360..2959551 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ8CKX4
KEGG IDypk:y2681
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 63 a.a.     [Download]
>gi|22126560|ref|NP_669983.1| hypothetical protein y2681 [Yersinia pestis KIM10+]
MPDTSSPSLYEQLLGNFTGGLDLHQVSDENQVILSVLDNMQRILNCRARNTQSSARLWPAGHE
 
Nucleotide Sequence: 192 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c2959551-2959360 Yersinia pestis KIM 10 chromosome, complete genome
ATGCCGGATACCTCCTCGCCGTCACTGTATGAGCAATTGCTGGGCAATTTCACCGGCGGGCTTGACCTGC
ATCAGGTCAGTGACGAAAACCAGGTCATTCTCTCGGTGCTGGACAATATGCAGCGCATTCTTAATTGTCG
GGCCCGGAACACTCAGTCATCTGCCCGATTATGGCCTGCCGGACATGAGTAA