SecReT6
Protein ID: 22126563
SecReT6 ID32
T6SS typei2
Gene symbol-
Locus tagy2684
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]2961156..2962919 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ7CHP0
KEGG IDypk:y2684, ypm:YP_1375, ype:YPO1485
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-183, Aligned region: 6..583
Protein Sequence: 587 a.a.     [Download]
>gi|22126563|ref|NP_669986.1| hypothetical protein y2684 [Yersinia pestis KIM10+]
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSIVEFTPQWQGMKERMGVSKGFEVLSRPIGERETRCRYTTTQEMDLLPLT
LRRAGLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYFDADAPLACALHEALTLNTAKLWIRLPGQAD
RQPLDGHFAPLGFGEQDTLWPKADSAFSGYQLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLE
KRWQHDFSFSEKNLRLHCVPVINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQ
VYVPFTSFRHKGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAEVLRGTLALYD
WTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGDICLFGEMLSRFFALYTDIHL
FNRLTLILQPTGERLEWEENHQSRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c2962919-2961156 Yersinia pestis KIM 10 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTTTGACGCTGAAATGCGCTACCTGCGCGAAGCGGGCGAAGAGTTTG
CTCGTGCGCACCCTGATCGGGCTGCCGGATTAAATCTGGATAAAGCCGGGGCGCGTGACCCCTATGTCGA
ACGCCTATTTGAAGGCTTTGCCTTTCTGATGGGCCGACTGCGGGAAAAACTGGATGACGACCTGCCGGAA
CTGACCGAAGGGTTGGTCAGCCTGCTGTGGCCGCACTACCTGCGTACCATTCCGTCGCTTTCTATTGTGG
AGTTCACCCCACAATGGCAGGGGATGAAAGAGCGCATGGGGGTGAGTAAAGGTTTTGAAGTGCTGTCCCG
CCCCATTGGTGAACGTGAAACCCGTTGCCGCTATACCACCACGCAAGAGATGGACCTGCTCCCGCTGACC
CTGCGCCGTGCCGGGCTGGACAGTGAACCCGATGGCCGGTCGGTTATCCGGCTGCGCTTTGATTGCAGCG
CGCTGGCCGACTGGAGCCGTATCAACCTGAGCCGCCTGCCGCTCTATTTTGATGCCGATGCGCCGCTGGC
CTGCGCCCTGCATGAGGCGCTGACCCTGAATACCGCCAAACTCTGGATCCGTTTGCCGGGGCAGGCTGAT
CGCCAGCCGCTGGACGGCCATTTCGCGCCGCTGGGGTTCGGGGAGCAGGATACACTGTGGCCGAAGGCCG
ACAGTGCGTTCAGTGGTTATCAGCTCTTGCTGGAGTACTTTACCTTCCGCGAAAAGTTTATGTTTGTCGC
GTTGCAGGGGCTGGATGGGATCGAGCTGCCGGCGGAACTGCCGTGGTTTGAGATTGATGTGGTGCTGGAA
AAACGCTGGCAACATGATTTCTCGTTCTCCGAAAAGAACCTGCGCCTGCATTGTGTGCCGGTGATTAACC
TGTTCCCGCTGGAATCGGACCCGCTGTCACTTTCTTCATTACAGACCGAATACCTGCTGCGCCCAATGCG
CATTCAGGACGGTTATACCGAAGTGTATTCGGTGGACTCGGTGATCTCCTCCCGTCATACCGGGCATCAG
GTCTATGTCCCTTTCACCAGCTTTCGCCACAAGGGGGGGATGTTGCGCCATGATGCGCCGGAGTATTACT
ACCATACGCGGGTCAAACGCGGGCCTTCGGGGTTACACGATACCTGGCTGGTGCTGGGGGGCGAGGCGTT
TGATAACCACAGCGTACCGGATAATGAAAATTTGTCGCTGAGCCTGACCGGCACCAACGGGCAGTTACCG
CGTAAAGCGCTGCAAAGCACGGTGCTGGATACGGCGGTGAAATCCACCGGGGCTCAGGTGCGGGTGCGTA
ATCTCTCCGCGCCGTCATTGCCATGCTACCCGCCGAACCGCGACCGTTTTCACTGGCGGGTGCTGAGCCA
TCTGGGCAGTAGTTTTCTGTGGATGATGGATAACGCCGAAGTGCTGCGCGGCACGCTGGCGCTGTATGAC
TGGACGGACAACGAAATGAACCGCCGTCGGCTGGAGGCGATCGCCGAGGTCAAACACAGCGAGATTGAAC
GCTTTGAGCGGGGCTATTTGCTGCGCGGGGTGCACATTGAAATCACCCTCGACAGCAACGGCTTTACCGG
TACCGGGGATATTTGTCTGTTTGGGGAAATGCTCAGTCGCTTCTTTGCCCTGTATACCGATATTCACCTG
TTTAATCGTCTGACTCTGATACTGCAACCGACAGGAGAACGTTTGGAATGGGAAGAGAATCATCAGTCCC
GCCTTCCCGGCTAA