SecReT6
Protein ID: 22126577
SecReT6 ID32
T6SS typei2
Gene symbol-
Locus tagy2698
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]2979489..2981837 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ8CKW7
KEGG IDypk:y2698
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-64, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 4.90E-48, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 3.20E-35, Aligned region: 488..591
Phage_base_V [PF04717], Evalue: 8.80E-16, Aligned region: 390..481
Protein Sequence: 782 a.a.     [Download]
>gi|22126577|ref|NP_670000.1| hypothetical protein y2698 [Yersinia pestis KIM10+]
MNTFLPTIRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIGPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADLTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIITRI
TSHARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWESGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGVLRAEKGLFITAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPADLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQMSASENLIATAGKNADVSVAKNFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELL
ARKAITITSTEDEIKITAKKRITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAA
KTEDPIKRWLFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c2981837-2979489 Yersinia pestis KIM 10 chromosome, complete genome
ATGAATACCTTTCTCCCGACTATTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCATGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGGCCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTGACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAATCGGTCTGGGACCTGT
CCAGCGCCCATCAGGTGGTGGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
CCTGACCGCCGGGGCCGACATCACGCGCGGCGATACCACCACCTACGGCGAAGCCTATCATTACGCCGAT
AACTATCTGACCGCAGGCAGCGAAGGGCGCGAGCCGGAAAGTGAAAGTGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGGCACCGGG
TCAGGAACTGAACGTCACCGGCAACGACGTGCCAGCACAGTTTGGTAAAGGGGTGATAATCACCCGCATC
ACCAGCCATGCCCGCCGCGACCGCAGCTATGAAGTACATTTTGAAGCCATTCCTTACTCCGAGGATTATT
GCTTCCGTCCGGCGCTGATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCGAACGACACTTATGGTCATATCGACAAAGACGGGCGCTACCGTGTCAACCTGATGTTCGACCGTGAC
AGTTGGGAGTCGGGTTACGAAAGCTTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCAGGCACCGAAGTGGCGATCGCGTTTGAAGACGGCAACCCGGACCGGCCGTA
TATCGCCTATGTGCTACACGACTCGGCGCACGGCGACCATGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGTACTCCGTCGAATAACAAACTGCGCCTGGAGGATGAACGGGGTAAAGAGCACATCAAGCTCAGCA
CCGAATATGGCGGCAAAAGCCAACTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGTATTACGGGCAGAAAAAGGCCTCTTTATCACTGCCGAC
GGACAGGCCAAAGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGTAGCGGGGAGCATCTGCAAATGAGTGCCAGCGAAAATCTGATTGCCACCGCCGGTAAAAATG
CCGACGTCAGCGTCGCGAAAAATTTCTTTATCGGCGTAGGCAATACCCTAAGTATCTTCGTCAGAAAGCT
GGGGATGAAACTAATAGCCAATCAGGGGCCGATAACAGTCCAGGCGCAGAATGATCTAATGGAGTTATTG
GCGCGTAAAGCGATCACCATTACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAGGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGGTTAGATAAGGCCAAACTCCCAACTGAATTTCCAGCCTTAGCCGCT
AAAACTGAAGACCCCATTAAACGTTGGCTATTCTCTTAA