SecReT6
Protein ID: 22126578
SecReT6 ID32
T6SS typei2
Gene symbolclpB
Locus tagy2699
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]2981840..2984479 [-]
Productheat shock protein
NoteTssH
UniProt IDQ8D065
KEGG IDypk:y2699
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-40, Aligned region: 237..256
AAA_2 [PF07724], Evalue: 2.00E-40, Aligned region: 610..774
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 239..369
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 615..733
AAA_5 [PF07728], Evalue: 5.00E-15, Aligned region: 239..263
AAA_5 [PF07728], Evalue: 5.00E-15, Aligned region: 614..735
ClpB_D2-small [PF10431], Evalue: 7.20E-15, Aligned region: 781..859
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 127..197
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 216..260
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 284..317
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 453..531
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 587..658
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 679..709
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 752..796
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 239..264
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 293..327
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 612..643
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 61..111
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 238..320
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 613..651
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 233..299
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 614..634
Arch_ATPase [PF01637], Evalue: 2.40E-06, Aligned region: 217..255
Arch_ATPase [PF01637], Evalue: 2.40E-06, Aligned region: 291..389
Arch_ATPase [PF01637], Evalue: 2.40E-06, Aligned region: 607..653
Arch_ATPase [PF01637], Evalue: 2.40E-06, Aligned region: 684..701
NACHT [PF05729], Evalue: 3.00E-06, Aligned region: 239..336
NACHT [PF05729], Evalue: 3.00E-06, Aligned region: 614..635
NACHT [PF05729], Evalue: 3.00E-06, Aligned region: 742..759
Zeta_toxin [PF06414], Evalue: 9.50E-06, Aligned region: 234..263
Zeta_toxin [PF06414], Evalue: 9.50E-06, Aligned region: 448..515
Zeta_toxin [PF06414], Evalue: 9.50E-06, Aligned region: 613..654
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 236..260
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 612..636
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 239..336
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 613..704
AAA_17 [PF13207], Evalue: 4.80E-05, Aligned region: 239..304
AAA_17 [PF13207], Evalue: 4.80E-05, Aligned region: 613..650
Sigma54_activat [PF00158], Evalue: 5.40E-05, Aligned region: 220..253
Sigma54_activat [PF00158], Evalue: 5.40E-05, Aligned region: 614..731
Clp_N [PF02861], Evalue: 0.00089, Aligned region: 23..59
Clp_N [PF02861], Evalue: 0.00089, Aligned region: 111..124
Clp_N [PF02861], Evalue: 0.00089, Aligned region: 452..471
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 237..256
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 310..319
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 574..635
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 240..261
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 615..636
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 239..266
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 615..644
AAA_33 [PF13671], Evalue: 0.0064, Aligned region: 239..256
AAA_33 [PF13671], Evalue: 0.0064, Aligned region: 613..636
DUF258 [PF03193], Evalue: 0.0064, Aligned region: 221..257
DUF258 [PF03193], Evalue: 0.0064, Aligned region: 614..627
SRP54 [PF00448], Evalue: 0.0086, Aligned region: 239..260
SRP54 [PF00448], Evalue: 0.0086, Aligned region: 613..659
Protein Sequence: 879 a.a.     [Download]
>gi|22126578|ref|NP_670001.1| heat shock protein [Yersinia pestis KIM10+]
MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLLEQGEGDITVIARRYEWDMDSLWQGL
LSHLDTLPRTVQGKPQLSAALQQLIKNAWLDASLQENADAVRSVHLMAALIATPSLLVAEAAWPLLSLST
TQLQRLLPLLDNQSDERPEVQQAAALADSPVNLTDEAATVTSASGQPQLNDALQAALDKFTLDVTAKARA
NQIDPIFGRDSEIRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIADGNVPDSLKTVSVRTLDLGL
LQAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAAT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGVHILDAAITAAVTLSRRFLTGRQ
LPDKAVDLLDTAGARVRMSIDTLPTALMEINAELAALAMEQQAIEQDLLLLPNVSSTRLPEIEQRRAALA
VGQHTLEQQYKEEKRLTTLIIEARQDIANAAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGVP
LGSLLKDEQTNLLSLENRLGERVIGQDAALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETALA
LADSLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVL
NLFYQVFDRGFMRDGEGREIDFRNTVIVMTANLGSDHLMQLLDEQPDAPDSTLHELLRPILRDHFQPALL
ARFQTLIYRPLQVDALKRIVAIKLNQVAQRLHCHYGLSCQIEDSLTDTLVAACLLPDTGARNIDSLLNQQ
ILPVLSQQLLSRMSEQQRTTSLTLGWHEEDGITLTFEGE
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c2984479-2981840 Yersinia pestis KIM 10 chromosome, complete genome
ATGACAACGCATTCAGCACACTTATTACGTCGGTTAAATCCCTATTGCGCACAGGCACTGGCCGGTGCCG
CCACCCTGTGTCAGACCCGCGCCCATGCTGAGATCACTGTCGAACACTGGTTGTTAAAATTGCTGGAGCA
GGGCGAAGGCGATATTACAGTCATTGCCCGGCGTTATGAGTGGGACATGGACAGCCTGTGGCAGGGATTA
CTGTCCCATCTGGACACCTTGCCGCGCACGGTACAGGGCAAACCTCAGTTGTCCGCCGCGTTACAGCAAC
TGATCAAAAACGCCTGGCTGGATGCCTCGTTGCAGGAAAATGCTGATGCGGTGCGCTCGGTTCATCTAAT
GGCAGCGCTGATTGCCACGCCGTCATTATTGGTCGCCGAGGCCGCCTGGCCGTTGCTCAGCCTGAGCACC
ACTCAGCTACAGCGCCTGTTACCGCTGCTGGACAACCAGTCCGACGAACGCCCTGAGGTGCAGCAGGCTG
CGGCACTGGCCGACAGCCCGGTCAATCTGACCGATGAGGCCGCGACGGTTACCTCCGCCAGTGGTCAGCC
GCAACTGAATGACGCGCTGCAAGCGGCGCTGGATAAATTCACCCTCGACGTCACCGCCAAAGCCCGTGCC
AACCAGATTGACCCGATTTTTGGCCGCGACAGCGAAATCCGCCAGATGATCGACATCCTGTCGCGCCGCC
GTAAAAACAACCCGATTCTGGTGGGTGAACCGGGTGTGGGGAAAACCGCGCTGGTTGAAGGGCTGGCACT
GCGGATTGCCGACGGCAACGTACCGGACAGCCTGAAAACCGTCAGTGTGCGCACACTGGATTTGGGTCTG
TTACAGGCCGGGGCTGGGGTGAAAGGCGAATTCGAACAGCGCCTGAAAAATGTTATCGAGGCGGTGCAAC
AATCCCCCAGCCCGGTGCTGCTGTTTATCGACGAAGCCCACACCATTATCGGGGCCGGTAATCAGGCCGG
TGGTGCCGATGCGGCCAACCTGCTGAAACCTGCACTGGCGCGTGGCGAACTGCGCACCATCGCCGCCACC
TGGTCCGAATACAAACAGTATTTTGAACGCGATGCCGCACTGGAGCGCCGCTTCCAGATGGTCAAAGTGG
ACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGTGGCCTGAAAGAACGTTACGCCACCCATCACGG
CGTGCATATTCTGGACGCCGCTATCACCGCAGCGGTTACCCTGTCGCGCCGCTTTCTGACCGGTCGCCAA
CTGCCGGACAAAGCGGTGGATCTTCTCGACACCGCAGGTGCGCGCGTGCGCATGAGCATCGACACCTTGC
CGACTGCGTTGATGGAGATTAACGCCGAACTGGCCGCACTGGCGATGGAGCAACAGGCCATCGAACAGGA
CTTGCTCCTGCTGCCGAATGTCAGTTCAACGCGCTTACCTGAGATTGAGCAACGCCGCGCCGCGCTGGCG
GTTGGGCAGCACACACTCGAACAGCAATATAAAGAAGAGAAGCGGTTGACCACCCTGATTATTGAGGCGC
GTCAGGACATCGCCAACGCAGCACATCTGGTCGCGTTGCAGGAGGAACTCGTTCAGATTCAGGGCAATGC
GCCGCTGTTGTCGCTGGACGTTGATGTGCGCACTGTTGCGGCTGTGATCGCCGACTGGACCGGTGTGCCG
CTGGGCAGTTTACTCAAAGACGAACAAACCAACTTGCTGTCACTGGAAAATCGTCTGGGTGAGCGAGTGA
TTGGGCAGGATGCGGCATTAGGTGCGCTGGCGCAACGGCTGCGGGCCGCCAAAACCGGCCTGACATCAGA
GAATGGCCCGCTGGGGGTGTTCCTGCTGGTCGGGCCGAGTGGGATCGGCAAAACCGAAACCGCGTTGGCA
CTGGCCGACAGCCTGTTCGGCGGGGAAAAATCGCTGATCACCATCAACTTATCGGAGTATCAGGAAGCGC
ACACCGTCTCCCAGTTGAAAGGGTCGCCCCCGGGTTATGTCGGTTACGGACAGGGCGGCGTATTAACCGA
AGCGGTACGTAAACGGCCTTACAGCGTGGTGCTGCTGGATGAAGTGGAAAAAGCCCATCGTGATGTGCTG
AACCTGTTCTATCAGGTGTTTGACCGGGGGTTCATGCGCGACGGTGAAGGGCGCGAAATTGATTTCCGCA
ACACGGTCATTGTGATGACCGCCAATCTGGGCAGTGATCATCTGATGCAGTTGCTGGATGAGCAACCGGA
CGCGCCGGACAGCACCCTGCATGAACTGCTGCGGCCGATCCTACGCGACCACTTCCAGCCCGCGCTGCTG
GCCCGCTTCCAGACCTTGATTTACCGCCCGCTTCAGGTGGATGCGCTCAAACGCATTGTGGCGATAAAAC
TGAATCAGGTGGCGCAACGCCTGCACTGTCACTACGGCCTGAGCTGCCAGATTGAAGACAGCCTGACCGA
CACACTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCACGCAACATCGACAGCCTGCTCAATCAGCAG
ATTTTACCGGTATTGAGCCAGCAGCTGTTAAGCCGCATGAGCGAGCAACAGCGCACCACCTCGCTGACGC
TGGGCTGGCATGAAGAAGATGGCATCACGCTGACATTTGAGGGCGAATAA