SecReT6
Protein ID: 22126583
SecReT6 ID32
T6SS typei2
Gene symbol-
Locus tagy2704
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]2987781..2989133 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ7CHN0
KEGG IDype:YPO0976, ypk:y2704, ypm:YP_1358
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.60E-135, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|22126583|ref|NP_670006.1| hypothetical protein y2704 [Yersinia pestis KIM10+]
MKIERPLWARGILVSPQQFQQQASWEAWTNECIAQMAVMHPWGVLQATFELDALAQGRLKAARLHVRFQD
GVLVDTECADVLPPTLTLAASLPAEASDATVMLAIPQLYANGGNCLQPDERGERPVRYRQAWRDVQNQFG
DDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQ
LRARLQRLMGMRRESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLT
FSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLRDPRLREGADF
YLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
TQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c2989133-2987781 Yersinia pestis KIM 10 chromosome, complete genome
ATGAAAATTGAACGCCCTCTGTGGGCTCGCGGGATCCTGGTGTCTCCGCAACAATTTCAACAACAGGCTT
CCTGGGAGGCATGGACCAATGAATGCATTGCGCAAATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGC
CACTTTTGAATTGGATGCATTGGCACAGGGCCGCCTGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGAC
GGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCTGCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCG
CCGAGGCCAGCGACGCCACGGTGATGCTGGCGATACCACAACTGTATGCCAATGGCGGTAACTGCCTGCA
GCCGGATGAGCGGGGCGAACGCCCGGTACGCTATCGTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGC
GATGACAAAAAGCAGGTCGCGGTGATGTACCACCAACTGACCCTGCGGCTGGACACTCAGGAAAACGGCG
ATTATCAGGTCTGCCCGGTGGCGCGTTTGCTGCGGGATGCGCAAGGTCGCTGGACACTGGATCCGGGCTT
TATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCTGGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAA
CTGCGGGCGCGTTTGCAGCGTCTGATGGGGATGCGCCGGGAGAGCAATGCACGGATGGCCGATTTTGCTG
TTGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCCCTTAACAGTGCCGAACCGGTATTGGGGAATTTTCA
GCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATCAGGAACTGGCCAGGCTGGCGGGCAGCCTGCTGACG
TTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGTTTATCAGCATGAACAACTGACCCGCGTCTTTCCCC
CGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCCAGCCTCCCTTCACGGGTAGTGGCGATTGAGCTGGT
TCATGAACCGCGTATCAATCAGTGGCGCGCGACCCTGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTC
TACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCAATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCG
GTGCGCCGGATGAGGTCGGTAACGTGGTGAATGTTGCGCTGAGTGGGATCCCACTGCGCCCGCTGAGCCA
TGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACCAGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCG
ACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTATGTACCCGGTACGCTGGGTGAGATCCAACTGGAGC
TGTTTGCGGTGCTACGCGCATGA