SecReT6
Protein ID: 22127237
SecReT6 ID33
T6SS typei2
Gene symbol-
Locus tagy3361
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]3702742..3705090 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7CGQ3
KEGG IDypk:y3361, ype:YPO0970
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-65, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 3.90E-48, Aligned region: 582..598
DUF2345 [PF10106], Evalue: 3.90E-48, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 2.90E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 2.90E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 1.80E-16, Aligned region: 393..481
Protein Sequence: 782 a.a.     [Download]
>gi|22127237|ref|NP_670660.1| hypothetical protein y3361 [Yersinia pestis KIM10+]
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQFGKGVIVTRI
TSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIASVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGRITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKANKPEDFPSVAP
ETTEPTSHFTFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c3705090-3702742 Yersinia pestis KIM 10 chromosome, complete genome
ATGAATACCACTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTGACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGGGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGACCGCAGGCAGTGAAGGGCGCGAGCCGGAAAGTGAAAGCGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGTCACCGGG
TCAGGAACTGAAAGTCACCGGCAACGACGTGCCAGCACAGTTTGGCAAAGGGGTGATAGTCACCCGCATC
ACCAGCCACGCCCGCCGCGACCGCAGCTATGAAGTGCATTTTGAGGCCATCCCTTACTCCGAAGAGTATT
GCTTCCGCCCGATCCTCATCAACAAGCCAAAAATGGCCGGCACCTTGCCCGCACGGGTCACCAGCACCAC
GGTGAACGACACTTACGGACACATCGACAAAGACGGCCGCTACCGTGTCAATCTGATGTTTGACCGGGAC
AGTTGGGAGCAAGGTTACGAAAGCCTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCCGGCACCGAAGTGGCGATTGCATTTGAGGACGGCAACCCGGACCGGCCGTA
TATCGCCTCTGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGCACTCCGTCGAACAACAAACTGCGCCTGGAGGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATCTGGTCGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGCCTTGCGGGCAGAAAAAGGGATTTTCATCAGCGCTGAC
GGCCAGGCGAAGGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCAACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGCAGTGGCGAACATTTACAACTGTCGGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATG
CGGATGTCAGTGTAGGTAAGAATTTTTTTATCGGTGTGGGCAACACGCTGAGCGTATTTGTACGCAAGCT
GGGGATAAAGTTGATAGCGAATCAGGGACGAATAACGGTACAGGCCCAGAATGATCTGATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAACCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGACAGGAAAAGGCAAATAAACCAGAAGATTTTCCGAGTGTTGCCCCG
GAAACAACAGAACCCACCAGTCATTTCACTTTTTCCTGA