SecReT6
Protein ID: 22127244
SecReT6 ID33
T6SS typei2
Gene symbol-
Locus tagy3368
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]3712431..3713975 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ7CHM9
KEGG IDypk:y2705, ypk:y3368, ypm:YP_1357, ype:YPO0977
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.50E-175, Aligned region: 15..53
DUF877 [PF05943], Evalue: 8.50E-175, Aligned region: 92..510
Protein Sequence: 514 a.a.     [Download]
>gi|22127244|ref|NP_670667.1| hypothetical protein y3368 [Yersinia pestis KIM10+]
MLMSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSV
FLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIE
LLDISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAA
HMPFIGSVGPEFFGKENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVP
VRSFNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVK
IPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c3713975-3712431 Yersinia pestis KIM 10 chromosome, complete genome
ATGCTGATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGG
CACAAGGGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGA
GGCGTTCCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTC
TTTTTAGACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATA
TTGCCGCACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGT
GGAATCGACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAG
CTGCTGGATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTT
TATACGCCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAGCCGATTGCCGCGGCTATCTCCAA
CTACGAGTTCGACCGTAGCCCGCAAGATATCGCGTTATTGCGCAATATCTCCAAGGTCGCGGCGGCAGCC
CATATGCCGTTTATCGGTTCCGTTGGCCCCGAGTTCTTTGGTAAAGAGAACATGGAAGACGTGGCAGCCA
TCAAAGATATCGCCAACTACTTTGACCGTGCTGAATACATCAAGTGGAAAGCCTTCCGCGACTCGGATGA
TTCCCGCTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCTTACGGCCCGGACACGGTGCCG
GTACGCAGCTTCAACTACGTTGAGCAGGTGAAAGGGCCGGATCATGATCGCTACTTGTGGACCAATGCCT
CATTTGCCTTTGCTGCTAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGGGGCCC
GCAGGCCGGTGGTGCGGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAA
ATTCCGTCAGAGGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGT
CGTACTACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGA
CACCGCGGATGCCACGGCCAACAGCCGCATCAACGCCCGTTTGCCGTATATCTTCCTGCTGTCGCGCATT
GCCCATTATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTGA
ACAACTGGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCATCCCCT
GCGTGATGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTGTATGCG
GTGCCGCATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCAAAGGCTAAGG
CATAA