SecReT6
Protein ID: 22127245
SecReT6 ID33
T6SS typei2
Gene symbol-
Locus tagy3369
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]3714018..3714521 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ8CK73
KEGG IDypk:y2706, ypk:y3369
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-56, Aligned region: 8..160
Protein Sequence: 167 a.a.     [Download]
>gi|22127245|ref|NP_670668.1| hypothetical protein y3369 [Yersinia pestis KIM10+]
MMSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLA
EFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRR
ELENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 504 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c3714521-3714018 Yersinia pestis KIM 10 chromosome, complete genome
TTGATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATA
CTGGCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCA
GGAGCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCT
GAATTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCT
CCCTGACCTTCAACGACATGAAAGATTTCGAGCCAGAAAACGTGGCCCGTCAAATTCCGCAACTGCGTGC
CTTGCTGGCCATGCGCAACCTGCTGCGAGACCTTAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGT
GAGCTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCGC
CAAAAGAGGGTTAA