SecReT6
Protein ID: 22127534
SecReT6 ID34
T6SS typei3
Gene symbol-
Locus tagy3660
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]4067397..4068770 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ8CKD7
KEGG IDypm:YP_3666, ypk:y3660
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-121, Aligned region: 25..452
Protein Sequence: 457 a.a.     [Download]
>gi|22127534|ref|NP_670957.1| hypothetical protein y3660 [Yersinia pestis KIM10+]
MQRTHNMLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGFHSLSINQGLLDQGKIALNQ
ASGVFPDGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLMDIPGNTYIDLKKSNQGSRFVALDAEVQDRN
HGVAAEGTPLIATLQLGQLQSKLTLRASVSDAESMLPVAYIKERTRDGRLILDDNFLPPMLDFRAIGWID
NAVTELLGLIVQRLESVYRPDVTLSVGGLSELLELLLLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLL
GRLSTIPGGEKPWSRQDLLYTHHEPHNGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQNDSQLR
LEKLIFTVSSKLPSETIRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRYIPYYPNSVYFEVDHD
DPMYKEMMSGSAIALSIVGDFPELRFEVWGLRQGRLG
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c4068770-4067397 Yersinia pestis KIM 10 chromosome, complete genome
TTGCAAAGGACTCATAATATGCTGCCAAAACAACGTGTTGCTTGGGTGGAAGGGATGCTGATGGAACCCC
AGCATTTTCAACAACAGGAACGATATCTAGAACATTTAACTGAAATGCGGGCACGTAGCCTCAGCGCGCT
GGCATGGGGCTTCCATAGCCTAAGTATCAATCAAGGGCTGCTGGATCAGGGCAAGATCGCCCTCAATCAG
GCCAGTGGTGTTTTCCCTGACGGTACACCTTTTCATATGGCGGGTGATGAGCCATTACCGCTACCTTTTG
ATCCGGGGGAGAACTGCCAAGGCAGTGTCGTGTGCCTTTCGGTCCTGATGGATATACCCGGCAATACCTA
TATTGATCTGAAGAAGAGCAACCAAGGTAGCCGTTTCGTTGCGCTGGATGCTGAAGTTCAAGACAGAAAC
CATGGCGTCGCTGCTGAAGGAACGCCATTGATCGCCACCCTTCAACTGGGGCAATTGCAATCCAAGCTCA
CCTTACGTGCCAGCGTCAGTGATGCAGAATCGATGCTGCCCGTAGCCTATATCAAAGAGCGCACCCGCGA
TGGGCGTCTGATTCTGGATGATAACTTCCTGCCACCCATGTTGGATTTTCGCGCCATAGGGTGGATCGAT
AATGCGGTAACCGAATTGCTAGGGTTGATCGTTCAGCGACTGGAATCGGTTTACCGGCCAGATGTGACGC
TCTCAGTCGGTGGGTTATCGGAGTTACTGGAACTGCTATTACTGCAAACACTCAGTGAATATAACCTAAA
GATTTCACATGTGTTGATGCAAAAACAGGTACACCCTGAGCAGTTGTTCCAATTATTGCTTGGGTTGTTG
GGGCGTCTCAGTACTATCCCTGGCGGAGAAAAACCGTGGTCGAGGCAGGATCTGCTCTATACGCATCATG
AACCGCACAACGGGTATTTCTCGCTGTTTGCCGCCTTACGGCGCGCACTCTCACTGGTGATCGAAGCACC
GGCAGTGGCGCTACCGTTTATCGAACGTGGCGACAATATTTACCTGTGCCAGAACGATTCACAACTGCGT
CTGGAAAAACTGATCTTCACCGTCAGTTCCAAACTGCCTTCCGAGACCATTCGCACTTACTTCCCGGCGC
AAACCAAACTGGGGCCGGTGGAGAAAATTGTACAGTTGATCGACCTGCAATTGCCTGGCGCACGGATGAT
CCCGATGTCATCACCGCCAAGATATATTCCTTATTACCCGAATAGCGTCTATTTCGAAGTTGACCATGAT
GATCCTATGTATAAAGAAATGATGTCTGGTTCAGCTATCGCACTCAGCATCGTGGGTGATTTCCCTGAGT
TGCGTTTTGAAGTATGGGGCTTGCGACAAGGAAGGCTCGGATGA