SecReT6
Protein ID: 22127535
SecReT6 ID34
T6SS typei3
Gene symbol-
Locus tagy3661
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]4068872..4069246 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ8CKD6
KEGG IDypk:y3661
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-11, Aligned region: 2..116
Protein Sequence: 124 a.a.     [Download]
>gi|22127535|ref|NP_670958.1| lipoprotein [Yersinia pestis KIM10+]
MQVVAAPLINPGPNGQAQPLKVCIIELNKEGWSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSR
DVPFEQERWWAIAAEFQEMSNGKSLLTLKSDARADFNRVVLVDGKALSLKASTK
 
Nucleotide Sequence: 375 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c4069246-4068872 Yersinia pestis KIM 10 chromosome, complete genome
TTGCAGGTTGTTGCGGCTCCTCTCATCAATCCTGGGCCCAACGGTCAGGCACAGCCCTTGAAGGTATGCA
TTATTGAGCTGAATAAAGAGGGGTGGTCACCCCCCGGTTTGTATCAGGGGACGCTCTGCAGTGGCATCAG
TGTAGGAGGTGAAGTCGTCAGCGTGACGGAATACATCCTTGCGCCGACAGAGGTGCGTCAATATTCCCGC
GATGTTCCCTTTGAACAAGAGCGCTGGTGGGCAATAGCGGCTGAGTTTCAGGAGATGAGTAACGGTAAAA
GCCTATTAACGCTGAAATCTGATGCCCGTGCGGACTTCAACCGTGTGGTGCTCGTTGATGGTAAGGCCCT
GTCATTAAAAGCGTCAACAAAGTAG