SecReT6
Protein ID: 22127544
SecReT6 ID34
T6SS typei3
Gene symbol-
Locus tagy3670
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]4078756..4079778 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ8CKD2
KEGG IDypk:y3670, ypm:YP_3674
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-66, Aligned region: 31..325
Protein Sequence: 340 a.a.     [Download]
>gi|22127544|ref|NP_670967.1| hypothetical protein y3670 [Yersinia pestis KIM10+]
MMVKPSPNGGLSTMASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRSHLRLRIIQPADM
GFAPREVSDIRQTLNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHARNEALAKRNQAFEHFAGILSQRM
AILHYRSWAQMHVAVGHDRASANPFMNHVRQIAGLTPQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEIL
SLYFSVPIRVEARKGLWIDDSRNIESQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRI
NTLVQICHDFVRHRMVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c4079778-4078756 Yersinia pestis KIM 10 chromosome, complete genome
TTGATGGTGAAACCTTCGCCAAATGGGGGCCTGTCAACTATGGCTAGCCTCCAGACGCTGAAAAACACGT
TTCTGCCGGGTATCTCGGCCAGTCAGGACTTTTTCGAGTTGCTGCGTCGCATTGAGCGTGCCACTCCAGA
GCAAGGCCGGCTTGGCACCCAACGTGATCGTAGCCATCTGCGGCTACGTATTATTCAGCCTGCCGATATG
GGATTTGCACCGCGTGAAGTGAGTGATATCAGGCAAACGCTGAACACTCATCAGCATCTGGCAGAGATCA
CCATTTTCTGCCGCCATTTTGGTTTATTTGCCCCGTATGGCCCGTTGCCAATACATGTTACCGAACATGC
TCGTAACGAAGCGTTGGCTAAACGTAATCAGGCCTTTGAACATTTTGCGGGCATTCTCAGCCAGCGAATG
GCGATCTTGCATTATCGCTCTTGGGCCCAAATGCACGTCGCCGTGGGGCATGATCGCGCGTCAGCCAATC
CCTTTATGAACCATGTGCGTCAAATCGCGGGCCTAACGCCGCAGCAAGCGCTGAATTCACATGTGGATCG
GGTACGGCGTTGCTTTCCGGGGGTGTATCTGCCGGGCAGAGGATCATTACGCAAATTACAGGAGATCCTG
AGCCTGTATTTCTCGGTTCCTATCCGTGTTGAAGCCCGTAAAGGATTGTGGATTGACGACTCGCGCAATA
TAGAAAGCCAACGTATGGGACGGTTGGGTAACACGCGTATTGGCAGCCGTTTCTTCGATGTGCAGCACAG
CCTGGTGTTATCTATTGGTCCGGTATCTGACCCCCAATATCTGGATTTTCAACGCAACAGCAAACGCATT
AACACTCTGGTGCAAATCTGCCATGACTTTGTCCGCCATCGGATGGTGCTGGACGTGCAATTAATCATAC
AGACCTCACCCAATATGGCTTGTCGTCTTGGCGGTGGAACGCTCAGTCGCCATAGCTGGTTAAAGCCAGG
CTCAGCCTTGAGTATACAGCCAATTTATAGAACGGTTACCTAG