SecReT6
Protein ID: 22127546
SecReT6 ID34
T6SS typei3
Gene symbol-
Locus tagy3672
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]4081609..4082052 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ7CG94
KEGG IDypm:YP_3676, ype:YPO0503, ypk:y3672
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.70E-14, Aligned region: 23..123
Protein Sequence: 147 a.a.     [Download]
>gi|22127546|ref|NP_670969.1| hypothetical protein y3672 [Yersinia pestis KIM10+]
MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARLKLKKYPHCEASVLNYGLPSLSQQVP
VITDLLELARHIQRIIATFESRLDPRSIKVVPLINKGETWVLAILFDIHARCNLPGEEHLVNLRIALDYS
YGMVRVL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c4082052-4081609 Yersinia pestis KIM 10 chromosome, complete genome
ATGGATATTTCAGCACCGATACTTTTTGACAAATTAAGTCTCCGCCATGAACACGTTCGCTTACCTCATT
GGCGTGAAGTGATTGTGCGCGATATTGAATCTTTATTGAATGACTCCGCACACAGTGCCCGGTTGAAGCT
AAAAAAGTATCCGCATTGTGAGGCTTCTGTATTGAATTACGGGCTGCCTTCGCTCAGTCAGCAGGTACCG
GTAATCACCGACTTGCTGGAACTGGCCAGACATATACAGCGGATCATCGCCACGTTTGAGTCACGCCTGG
ATCCGCGCTCAATAAAAGTGGTGCCGCTGATTAATAAAGGCGAAACCTGGGTGTTAGCCATCCTGTTTGA
CATTCATGCCCGGTGCAACCTACCGGGCGAAGAGCACTTGGTCAATTTACGCATCGCGCTCGATTACTCC
TATGGAATGGTTCGCGTTCTTTAA